SecReT4
Protein ID: 305696912
T4SS name [ID]Tra_F [82]
Gene symbolTraE
Locus tagpYT1_p084
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]79226..79792 [+]
Productconjugative transfer assembly protein
Component typeTraE_F
UniProt IDD0R7D9, E0D8G1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.2e-72, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|305696912|ref|YP_003864227.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MEHGARLSTSRVLAISFIFMALLIVLSLAVNVIQGINNYRLQNEQRTAVTPMGFNASFAVSQNSADASYL
QQMALSFIALRLNVSSETVDASHQALLQYIRPGAQNQMKVILAEEARRIKADNVNSAFFQTSVRVWPQYG
RVEIRGVLKTWIGDSKPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|305696832|ref|NC_014476.1|:79226-79792 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGGAACACGGCGCCCGTTTAAGTACCAGCCGCGTACTGGCAATAAGTTTTATTTTTATGGCCCTGCTGA
TTGTGCTCAGTCTGGCCGTGAATGTCATTCAGGGTATTAATAACTACCGGCTGCAGAATGAGCAACGCAC
GGCGGTCACTCCTATGGGATTTAACGCGTCCTTTGCGGTGTCACAGAACAGTGCCGATGCCTCTTATTTA
CAGCAGATGGCGCTGTCGTTTATTGCCCTGCGTCTGAATGTGTCGTCAGAAACCGTCGACGCGTCACACC
AGGCACTTCTGCAATATATTCGTCCGGGCGCACAGAACCAAATGAAAGTCATTCTGGCAGAAGAAGCGAG
ACGAATTAAGGCCGACAACGTTAACTCCGCTTTTTTCCAGACCAGTGTCAGGGTCTGGCCACAGTATGGC
CGCGTGGAAATTCGCGGTGTGCTGAAAACCTGGATTGGAGATTCAAAACCGTTTACCGACATCAAACATT
ACATTCTTATTCTGAAACGGGAAAACGGCGTGACCTGGCTGGATAATTTCGGGGAAACTGACGATGAGAA
AAAATAA
 Primer design