SecReT4
Protein ID: 305696913
T4SS name [ID]Tra_F [82]
Gene symbolTraK
Locus tagpYT1_p085
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]79779..80519 [+]
Productconjugative transfer assembly protein
Component typeTraK_F
UniProt IDH9L4L7, D0R7E0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 2.1e-72, Aligned region: 13..239
Protein Sequence: 246 a.a.     [Download]
>gi|305696913|ref|YP_003864228.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MRKNKPYKPFLLAAGWLFSGLVMASGSGTLAPVVVSLANGGQANIAVSNTDPNLFTVPGDRITAVSGLDG
MLTNSEQTGTGGVVVATVSKKPFTFILETERGLNFSVRAVPRAGAGRTVQLVSDLRGTGEEAGAWETATP
YESLLVAVSQAVRGGTLPAGWYQIPVTKEALQAPAGLSARADAVWTGNHLKLVRFAVENKMPSALNIRES
DFWQPGTRAVMFSQPVSQILAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 741 bp     [Download]
>gi|305696832|ref|NC_014476.1|:79779-80519 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGAGAAAAAATAAGCCGTATAAGCCATTTTTACTGGCGGCCGGATGGTTATTTTCCGGTCTGGTGATGG
CGTCGGGTTCCGGTACGCTGGCCCCGGTGGTGGTGTCCCTGGCTAACGGCGGTCAGGCGAACATTGCTGT
CAGCAACACCGACCCGAACCTGTTTACGGTACCGGGTGACCGTATCACTGCGGTCAGCGGTCTGGACGGC
ATGCTGACAAACAGTGAGCAGACAGGCACGGGCGGCGTGGTGGTGGCCACGGTCAGTAAAAAGCCGTTCA
CCTTCATTCTGGAGACGGAGCGCGGGCTGAACTTTTCCGTCCGGGCCGTCCCCCGGGCCGGTGCCGGACG
CACCGTACAACTGGTCAGCGACCTGCGCGGAACCGGGGAGGAGGCTGGCGCATGGGAAACGGCCACCCCT
TATGAATCCCTGCTGGTTGCCGTCAGCCAGGCAGTTCGTGGAGGCACGCTGCCTGCCGGCTGGTATCAGA
TCCCCGTCACGAAAGAAGCGCTGCAGGCCCCGGCCGGTCTGTCTGCACGGGCTGACGCTGTGTGGACCGG
CAATCACCTGAAACTGGTACGGTTTGCTGTGGAAAATAAAATGCCGTCAGCCCTGAACATCAGGGAAAGT
GATTTCTGGCAGCCCGGAACCCGCGCCGTGATGTTCAGCCAGCCCGTCAGCCAGATACTGGCCGGCGCAC
GAATGGACGTGTACGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design