SecReT4
Protein ID: 305696914
T4SS name [ID]Tra_F [82]
Gene symbolTraB
Locus tagpYT1_p086
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]80519..81940 [+]
Productconjugative transfer assembly protein
Component typeTraB_F
UniProt IDH9L4F6, D0R7E1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.6e-40, Aligned region: 211..407
CALCOCO1 [PF07888], Evalue: 5.9e-05, Aligned region: 67..120
Protein Sequence: 473 a.a.     [Download]
>gi|305696914|ref|YP_003864229.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MASINTVVKRKQYIWLGIVAVGAAAAIGGGLYLSDVDMSGNGTAAEQEPVPDMTGVVDTTFDDKVRQHAT
TEMQVTAAQMQKQYDEIRHELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTTTGEPVPHTPVS
PPGPEGEPQPGNTPMTFPPQGAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKTFSYDAAAKKGPSLP
YIPSGSFAKTMLIEGADANASVTGNESTVPMQLRITGPVEMPNSKTYDLTGCFVGLEAWGDVSSERAIVR
TRNISCLKDGKTIDMSVKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQQAVGLGAT
ATYGAGDVFRMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMAQEQARH
RKEDENAESPVPIPPSVDSHMNGFNTDQMLKQLGDLNPQQFMSGSQGGHVNGK
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|305696832|ref|NC_014476.1|:80519-81940 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGGCGAGCATCAATACGGTTGTAAAGCGTAAACAGTACATCTGGCTGGGGATTGTTGCGGTGGGGGCTG
CCGCTGCCATTGGCGGAGGCCTTTACCTGTCTGACGTCGACATGAGTGGCAACGGGACGGCCGCAGAGCA
GGAGCCGGTACCGGATATGACCGGGGTGGTGGACACGACCTTTGATGACAAAGTTCGTCAGCATGCCACC
ACGGAAATGCAGGTGACGGCGGCGCAGATGCAGAAACAGTACGACGAAATCCGCCATGAGCTGGATGTTC
TGAATAAGCAGCGCGGTGACGACCAGCGTCGTATTGAGAAGCTGGGGCAGGACAACGCCGCCCTGGCCGA
ACAGGTGAAGGCCCTGGGAGCGAACCCGGTGACGACCACAGGAGAGCCCGTGCCGCATACACCTGTCTCA
CCGCCCGGTCCGGAAGGAGAACCTCAGCCGGGTAATACGCCGATGACCTTCCCGCCACAGGGAGCCGTTC
CTCCGCCAACCGCTTTTTATCCGGGGAATGGCGTCACGCCTCCGCCACAGGTGACATACCAGTCCGTGCC
GGTGCCGAACCGTATACAGCGTAAAACGTTCAGCTATGACGCTGCCGCGAAGAAAGGTCCCTCCCTGCCG
TATATCCCGTCCGGGAGTTTTGCAAAAACCATGCTGATCGAAGGAGCGGATGCCAATGCCTCCGTCACCG
GTAATGAATCGACGGTCCCTATGCAGTTGCGCATTACCGGCCCGGTGGAGATGCCGAACAGTAAAACATA
TGACCTGACAGGGTGCTTTGTGGGTCTGGAAGCCTGGGGGGATGTGTCCAGTGAACGCGCGATAGTACGT
ACCCGTAATATCAGCTGCCTGAAGGACGGCAAAACCATCGACATGTCGGTTAAGGGACATGTCAGCTTCC
GTGGAAAGAACGGCATCAAGGGTGAAGTGGTGATGCGTAATGGCAAAATCCTCGGCTGGGCGTGGGGCGC
CGGTTTTGTGGACGGTATCGGCCAGGGGATGGAGCGGGCATCCCAGCAGGCGGTGGGGCTGGGGGCCACT
GCGACTTACGGCGCGGGCGATGTGTTCAGAATGGGGATTGGTGGTGGTGCATCGAAAGCGGCACAGACAC
TCAGTGATTATTACATCAAACGTGCCGAGCAGTATCACCCGGTGATCCCGATTGGTGCCGGTAATGAAGT
GACCGTGGTGTTTCAGGACGGTTTTCAGCTGAAAACCGTGGAAGAAATGGCACAGGAGCAGGCCCGTCAC
CGGAAGGAGGATGAAAATGCGGAAAGCCCGGTGCCTATACCTCCGTCAGTCGACAGCCATATGAACGGCT
TTAACACCGACCAGATGCTGAAGCAGCTGGGTGACCTGAATCCACAGCAGTTTATGTCCGGCAGCCAGGG
AGGACATGTAAATGGGAAATAA
 Primer design