SecReT4
Protein ID: 305696917
T4SS name [ID]Tra_F [82]
Gene symbolTraV
Locus tagpYT1_p089
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]82746..83261 [+]
Productconjugative transfer assembly protein
Component typeTraV_F
UniProt IDH9L4E1, D0R7E4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.8e-38, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|305696917|ref|YP_003864232.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MNRISCLIPFCGALLLSGCAGTNSDFECTATTSDTCMTMEQANEKAKRQEQPETVKPGAVSLPRLAEGNF
RTTPVQVVSTVTLPVAKTVAAPRSGQKPPAPHPLFTAAREVKPVAAVSTVSPVVPPRPLRTREQTAALWI
APYIDSQDIYHQPSGVFFVIKPSVWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|305696832|ref|NC_014476.1|:82746-83261 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGAACCGGATTTCATGCCTGATCCCTTTCTGTGGCGCGCTTCTGCTGTCCGGATGCGCCGGAACGAACT
CCGACTTTGAATGTACCGCCACCACGTCAGACACCTGTATGACGATGGAGCAGGCCAATGAAAAAGCGAA
AAGACAGGAGCAACCTGAGACGGTAAAGCCGGGTGCGGTATCACTGCCGCGCCTGGCTGAGGGTAACTTT
CGCACGACGCCGGTACAGGTAGTCAGTACCGTCACTCTACCCGTCGCAAAGACCGTGGCCGCCCCGCGTT
CCGGGCAGAAACCGCCGGCACCACACCCGCTGTTTACGGCTGCCCGGGAGGTGAAACCGGTGGCGGCTGT
CAGTACGGTCTCTCCTGTGGTGCCGCCCCGTCCACTGAGAACCAGGGAGCAGACGGCGGCGTTATGGATA
GCGCCCTATATTGACAGCCAGGATATTTACCATCAGCCGTCCGGCGTATTTTTTGTCATTAAACCGTCCG
TGTGGGGAAAGCCACGGATTAATTAA
 Primer design