SecReT4
Protein ID: 305696921
T4SS name [ID]Tra_F [82]
Gene symbolTraC
Locus tagpYT1_p093
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]84473..87121 [+]
Productconjugative transfer assembly protein
Component typeTraC_F
UniProt IDH9L4L8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.7e-57, Aligned region: 37..277
AAA_10 [PF12846], Evalue: 2.4e-44, Aligned region: 479..772
DUF87 [PF01935], Evalue: 1.9e-05, Aligned region: 482..668
TrwB_AAD_bind [PF10412], Evalue: 7.5e-05, Aligned region: 479..517
Protein Sequence: 882 a.a.     [Download]
>gi|305696921|ref|YP_003864236.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MKNLLDTVTQAANSLLTALKLPDESAQANQILGEMSFPQFSRLLPYRDYNQESGLFMNDATMGFMLEATP
VNGANETIALSLDHLLRTKLPRGIPLCVHLMSSQLVGERIEYGLRKFSWSGEQAERFNAITRAYYMKAAE
THFPLPEGMNLPLTLRHYRVFISYCAPSRKKSRADILEMENLVKIIRASLQGAYISTQTVDAKAFINIVG
EMINHNPESIHPTRRRLDPYSDLNYQCVDDSFDLKVRQDYLTLGLRDNGKNSTARIMSFHLARNPEIAFL
WNSADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGD
LRQRLASNQSSVVSYFFNITAFCRDNKETALETEQDILNSFRKNGFELISPRFNHMRNFLACLPFMAGKG
LFKQLKEAGVVQRAESFNVTNLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITNIDQSAERIRDQLSV
MASPNGNLDEVHEGLLLQAVRAAWLTKKNRARIDDVVDFLENARTSEQYAESPGIRSRLDEMIVLLNQYT
AAGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGDFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFPQLHREMIEKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLQEHETFRGTYEYKAETD
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|305696832|ref|NC_014476.1|:84473-87121 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
GTGAAGAACCTGCTTGATACTGTCACTCAGGCGGCCAACTCGCTGCTGACCGCGCTGAAGCTGCCGGATG
AATCGGCACAGGCCAATCAGATCCTCGGCGAGATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
GGACTATAACCAGGAGTCCGGCCTGTTCATGAATGACGCCACGATGGGCTTTATGCTGGAAGCCACGCCT
GTCAACGGCGCTAACGAGACCATTGCGCTCTCCCTTGACCATCTGCTGCGTACCAAACTGCCGCGCGGGA
TACCCCTGTGTGTCCACCTGATGTCCAGCCAGCTGGTCGGGGAGCGTATTGAGTACGGGCTGCGGAAGTT
CTCCTGGTCCGGTGAGCAGGCGGAGCGGTTCAACGCCATCACCCGCGCCTACTACATGAAAGCCGCAGAG
ACTCACTTTCCGTTACCGGAAGGAATGAACCTGCCCCTGACCCTGCGCCATTACCGGGTGTTCATCTCAT
ACTGCGCGCCCTCCAGAAAAAAAAGCCGGGCCGATATCCTGGAGATGGAAAACCTGGTGAAGATTATCCG
GGCTTCCCTGCAGGGGGCATACATCAGCACACAGACCGTTGATGCGAAGGCATTTATTAATATTGTCGGG
GAGATGATTAATCACAATCCGGAATCCATCCATCCGACCCGGCGCCGGCTGGACCCGTATTCCGACCTGA
ATTACCAGTGCGTGGACGACTCCTTTGACCTGAAGGTCAGGCAGGATTACCTGACGCTGGGACTGCGCGA
TAACGGGAAAAACAGCACCGCGCGCATCATGAGTTTTCATCTGGCCCGTAACCCGGAAATCGCCTTCCTG
TGGAACTCGGCGGATAATTACAGCAATCTGCTGAACCCGGAGCTGTCCATCTCCTGTCCGTTCATTCTGA
CGCTGACCCTGGTGGTGGAAGACCAGGTGAAGACCCACAGCGAAGCGAACCTGAAGTACATGGATCTGGA
GAAGAAGTCGAAGACCTCCTACGCCAAATGGTTCCCGTCCGTGGAGAAGGAAGCGAAGGAGTGGGGAGAC
CTGCGCCAGCGCCTGGCGTCGAACCAGTCCTCGGTGGTGTCCTACTTTTTCAATATCACGGCGTTCTGCC
GCGACAACAAGGAAACGGCGCTGGAAACGGAGCAGGATATCCTGAACAGTTTCCGTAAAAACGGTTTTGA
GCTGATTTCGCCGCGCTTTAACCACATGCGTAATTTCCTGGCCTGCCTGCCCTTTATGGCCGGGAAGGGA
CTGTTTAAGCAGCTGAAGGAAGCCGGTGTGGTGCAGCGGGCGGAGAGCTTCAATGTGACCAACCTGATGC
CCCTGGTGGCGGATAACCCGCTGACGCCCGCCGGGCTGCTGGCTCCGACCTACCGTAACCAGCTGGCCTT
TATTGATATTTTCTTCCGGGGAATGAACAACACCAACTACAACATGGCGGTCTGCGGAACTTCCGGGGCG
GGCAAGACCGGGCTGATACAGCCGCTTATCCGCAGCGTGCTGGATTCCGGCGGCTTTGCAGTGGTGTTTG
ACATGGGGGACGGGTACAAGTCCCTGTGCGAAAATATGGGCGGGGTGTACCTGGACGGGGAGACCCTGCG
TTTTAACCCCTTCGCCAATATCACCAATATTGACCAGTCGGCCGAACGTATCCGCGACCAGTTGTCGGTG
ATGGCCAGCCCCAACGGCAACCTTGACGAAGTCCATGAGGGCCTGTTGCTGCAGGCGGTCAGGGCAGCCT
GGCTGACAAAAAAGAACCGGGCGCGTATTGATGACGTGGTGGATTTTCTGGAAAACGCCCGCACGAGCGA
ACAGTATGCGGAGTCACCCGGTATCCGCAGCCGCCTGGATGAAATGATTGTCCTGCTGAACCAGTACACG
GCAGCAGGCACTTACGGCAGATACTTCAACTCCGATGAACCCTCCCTGCGCGATGATGCCAGGATGGTGG
TGCTGGAGCTGGGTGGCCTGGAAGACCGCCCGTCCCTGCTGGTTGCGGTGATGTTTTCCCTGATTATCTA
CATCGAAAACCGGATGTACCGCACGCCGCGTAACCTCAAAAAGCTGAACGTGATCGACGAAGGCTGGCGT
CTGCTGGACTTCAAAAACCGCAAGGTCGGGGACTTCATCGAAAAAGGCTACCGTACTGCCCGCCGTCACA
CCGGCGCGTATATCACCATCACGCAGAATATCGTCGACTTTGACTCCGACAAGGCGTCCAGCGCCGCCCG
CGCGGCATGGGGTAACTCTTCCTACAAAATTATCCTCAAACAGAGCGCCAAAGAATTCGCGAAATACAAC
CAGCTGTATCCGGATCAGTTCCCGCAGCTACACCGGGAGATGATTGAGAAATTTGGCGCCGCGAAAGACC
AGTGGTTCAGCTCGTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGTCTGTTTGTCGACCCGCT
CAGCCGCGCCATGTACAGCTCGGACGGTCCTGATTTTGAGTTTGTACAGCAGAAGCGGAAAGAGGGGCTG
AGTATTCACGAGGCGGTCTGGCAGCTGGCGTGGAAAAAGTCAGGACCGGAGATGGCCTCGCTGGAGGCCT
GGCTGCAGGAGCATGAGACATTCAGGGGAACTTATGAGTACAAAGCAGAAACAGACTGA
 Primer design