SecReT4
Protein ID: 305696923
T4SS name [ID]Tra_F [82]
Gene symbolTraW
Locus tagpYT1_p095
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]87479..88111 [+]
Productconjugative transfer assembly protein
Component typeTraW_F
UniProt IDH9L4K9, D0R7F0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 5.4e-09, Aligned region: 3..30
Protein Sequence: 210 a.a.     [Download]
>gi|305696923|ref|YP_003864238.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MKWRGLTALLIWGQSVAAADLGTWGDLWPVQEPDMLAVIMHRLEALQQSGEMGRRMEAFKERVIHNSLRP
PAVPGIGRAEKYRSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPEQVSWMKR
QTPPTLESKIILVQGSIPEMEKALDSRIYFDQNGVLCQRLGIDQVPARVTAAKDGRFLKVEFIPAEDGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|305696832|ref|NC_014476.1|:87479-88111 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
GTGAAATGGCGGGGGCTGACAGCCCTGCTGATATGGGGGCAGAGCGTGGCGGCCGCAGACCTGGGCACCT
GGGGCGATCTGTGGCCGGTGCAGGAGCCGGACATGCTGGCGGTGATTATGCACCGGCTGGAAGCCCTGCA
GCAGTCCGGTGAGATGGGCCGCCGGATGGAGGCCTTTAAGGAGCGGGTGATCCACAACAGCCTGCGACCG
CCTGCGGTGCCGGGTATCGGGCGCGCGGAGAAATACCGCAGCCGGCTGTTTGATCCGTCGGTCAGACTGG
CGGCCGATATCCGGGATAACGAAGGACGGGTGTTTGCCCGTCAGGGGGAGGTGATGAATCCGCTGCAGTA
TGTGCCCTTTAACCAGACGCTGTATTTCATTAACGGCGATGATCCGGAACAGGTGTCGTGGATGAAACGC
CAGACGCCGCCGACGCTGGAGAGCAAAATTATTCTGGTGCAGGGCAGTATCCCTGAGATGGAGAAGGCGC
TGGACAGCCGGATTTACTTTGACCAGAACGGGGTGCTGTGTCAGCGCCTCGGGATCGACCAGGTGCCGGC
CAGGGTGACGGCCGCAAAAGACGGGCGTTTCCTGAAAGTGGAATTTATTCCGGCGGAGGACGGCAGAAAA
TGA
 Primer design