SecReT4
Protein ID: 305696924
T4SS name [ID]Tra_F [82]
Gene symbolTraU
Locus tagpYT1_p096
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]88108..89100 [+]
Productconjugative transfer assembly protein
Component typeTraU_F
UniProt IDH9L4I0, D0R7F1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.6e-83, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|305696924|ref|YP_003864239.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MKRYLWLCVLILLAGHVPTVSADAACESRFVNPITDICWSCIFPLSLGSTKVSQGKLPDTANPSMPLQFC
PAPPPIFKRPGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKEDKQVNGAFYHVHWYKYP
LTYWLNIITSMGCLEGGDLDIAYLSEIDPTWTDSSLTSILNPEAVIFANPIAQGACAADAIASTFNKPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGQIMETIGQNTAVCFEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|305696832|ref|NC_014476.1|:88108-89100 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGAAACGGTATCTGTGGCTGTGTGTACTGATTCTGCTGGCCGGTCATGTCCCCACGGTATCGGCTGATG
CGGCCTGTGAAAGTCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGCATCTTTCCGCTGTCGCT
GGGCAGTACAAAAGTGAGTCAGGGAAAGCTGCCGGATACGGCCAATCCCTCAATGCCGCTCCAGTTCTGT
CCGGCGCCGCCGCCCATTTTTAAGCGTCCCGGACTGGCGATTGGCTACTGGGAGCCAATGGCGCTGACGG
ACGTCACCCGCTCTCCGGGCTGCATGGTGAATCTGGGGTTCAGCCTGCCGGCCTTCGGGAAAACGGCACA
GGGTACGGCGAAGAAGGAGGATAAACAGGTGAACGGGGCGTTCTACCACGTTCACTGGTACAAATACCCG
CTCACGTACTGGCTGAATATCATCACGTCGATGGGGTGTCTGGAGGGCGGTGACCTGGACATTGCGTACC
TCTCCGAAATCGACCCCACGTGGACGGACAGCAGCCTGACCAGCATTCTCAATCCGGAAGCGGTAATTTT
TGCCAATCCCATAGCCCAGGGGGCCTGCGCGGCAGATGCCATTGCCAGCACCTTCAATAAACCGCTGGAT
GTCCTGTTCTGGTGTGCAGGCTCTCAGGGCTCCATGTATCCGTTTAACGGCTGGGTGAGTAACGAATCCA
GTCCGCTGCAGTCCTCCCTGCTGGTCAGTGAGCGGATGGCCTTCAAACTGCACCGGCAGGGGCAAATTAT
GGAGACCATCGGGCAGAATACCGCCGTCTGCTTTGAATATCCGTCGCCCATTCTCCCTAAAGAGCGCTGG
CGTTATCAGATGGTGAACATGTATCCGGACAGCGGGCAGTGCCACCCGTTCGGGCGCAGTGTGATGCGCT
GGGAAACCGGGAAAAATCCACCCAACACGAAGAAGAACTTTGGCTATCTGATGTGGCGTAAGCGCAACTG
TGTATTTCTGTAA
 Primer design