SecReT4
Protein ID: 305696926
T4SS name [ID]Tra_F [82]
Gene symbolTrbC
Locus tagpYT1_p098
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]89412..90050 [+]
Productconjugative transfer assembly protein
Component typeTrbC_F
UniProt IDD0R7F3, H9L4M1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.2e-27, Aligned region: 94..190
Protein Sequence: 212 a.a.     [Download]
>gi|305696926|ref|YP_003864241.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MHRKIKYLAGLIMVISGTVSAGGVANTPENRQFLKQQEELSRQLRDRPDAELKAWADRQIQANPLVQSDR
HFLDDLARKQQTSQADKPEQGAVYFISFSIPEEGLKRMLGETRRYGIPATLRGMRDNDLKATADAVLSLV
KDGATDGVQIDPTLFTKYDIRSVPTLVVYCRQGYDVIRGNLRVKQALEKVVTAGDCRQVAAGLLDGAGDK
PQ
 
Nucleotide Sequence: 639 bp     [Download]
>gi|305696832|ref|NC_014476.1|:89412-90050 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGCACAGGAAAATAAAATACCTGGCCGGACTGATTATGGTCATAAGCGGGACGGTATCAGCCGGCGGAG
TCGCTAATACCCCTGAAAACCGCCAGTTCCTGAAGCAGCAGGAGGAACTGAGCCGGCAGTTGCGCGACCG
GCCTGATGCTGAACTGAAAGCGTGGGCAGACCGGCAGATTCAAGCGAATCCCCTGGTGCAGTCAGACCGG
CATTTCCTGGATGACCTTGCCCGAAAGCAGCAGACTTCTCAGGCGGATAAACCGGAGCAGGGCGCGGTGT
ACTTTATCTCGTTTTCCATTCCGGAAGAGGGGCTGAAGCGCATGCTGGGCGAAACCCGTCGCTACGGTAT
TCCGGCCACGCTGCGGGGAATGCGGGATAACGACCTGAAAGCCACGGCAGATGCCGTTCTGTCCCTGGTA
AAGGATGGGGCAACAGATGGTGTGCAGATTGACCCGACGCTGTTCACGAAATATGACATCCGCAGCGTAC
CGACTCTGGTGGTGTACTGCCGACAGGGATATGACGTTATCCGGGGCAATCTGCGGGTGAAGCAGGCGCT
GGAGAAAGTGGTCACCGCCGGGGACTGCAGGCAGGTGGCTGCCGGATTACTTGATGGTGCCGGAGATAAA
CCGCAATGA
 Primer design