SecReT4
Protein ID: 305696928
T4SS name [ID]Tra_F [82]
Gene symbolTraN
Locus tagpYT1_p100
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]90503..92329 [+]
Productconjugative transfer aggregate stability protein
Component typeTraN_F
UniProt IDH9L4E7, D0R7F5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.9e-75, Aligned region: 314..558
Protein Sequence: 608 a.a.     [Download]
>gi|305696928|ref|YP_003864243.1| conjugative transfer aggregate stability protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MKRMLPLFLLLAAGQAQADSNSDYRAGSDFAHQIKGQGTGSIRNFNPQESIPGYNANPDETKYYGGVTAG
GDSGLKNDGTTQWATGETGKTITESFMNKPKDILSPDAPFIEKGRDVVNRADSIVGNTGQQCSAQEINRS
EFTNYTCERDTTVEEYCTRTATITGDWRETTEVRTYTLTAFSFSRSGKQIVFSVTVPEAGTISSASLNVI
TQNYLWNSRAGFMNTIFNMTWGSTITLGGATGMMLSKGQILSGTSCSGNGSCTGTLDDRIFNELTSGRTT
FTLTLVMQVKDREWIPRVEWVESCPFNKADGVLKGTECSEPGGTKTGVMEGKPWSLTEACWAYRDKYVTQ
SADNGTCQAYVDNPACTLATRQCAFYSGEGTCLHEYATYSCESKTSGKVMICGGDVFCLDGECDKAQSGK
SNDFGEAVSQLAALAAAGKDVAALNGIDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKA
LAKAKTNKLTVSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQLHISFGSSKHPDCRGITVD
ELQQIKFDQLDLTNFYEDLMNNQKIPDSGALTEKVKEQIADQLRQAGK
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|305696832|ref|NC_014476.1|:90503-92329 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGAAACGTATGTTACCTCTGTTTCTGCTTCTGGCAGCCGGCCAGGCACAGGCTGACAGTAACAGTGATT
ATCGTGCGGGTTCAGATTTTGCCCATCAGATCAAAGGCCAGGGCACCGGCAGTATCCGGAATTTTAATCC
GCAGGAGAGTATACCCGGCTATAACGCGAATCCGGATGAAACGAAATATTACGGTGGCGTGACCGCCGGT
GGTGACAGTGGGCTGAAGAATGACGGCACGACGCAGTGGGCCACAGGCGAAACCGGTAAAACCATTACAG
AATCGTTCATGAACAAGCCCAAAGATATTCTGTCACCGGATGCGCCGTTTATTGAAAAAGGAAGGGATGT
GGTGAACCGTGCCGACAGTATTGTGGGAAATACCGGGCAGCAGTGCAGCGCGCAGGAGATTAACCGCAGC
GAATTCACGAATTATACCTGTGAACGCGACACCACTGTGGAGGAATACTGTACCCGGACGGCCACCATCA
CCGGCGACTGGAGAGAGACAACAGAGGTCAGAACCTACACCCTCACCGCCTTTAGTTTCAGCCGTTCCGG
TAAGCAGATCGTTTTCAGCGTAACCGTGCCGGAAGCGGGTACGATAAGCAGCGCCAGCCTGAATGTGATC
ACACAGAATTATCTGTGGAATTCCCGTGCCGGCTTTATGAATACCATCTTCAACATGACGTGGGGCAGTA
CCATTACACTGGGTGGCGCGACGGGAATGATGCTGAGTAAGGGCCAGATTCTGAGCGGGACAAGCTGCAG
CGGGAACGGTAGCTGTACCGGGACGCTGGATGACCGCATTTTTAACGAACTGACCAGCGGGAGAACGACG
TTCACGCTGACACTGGTGATGCAGGTAAAGGACCGGGAGTGGATACCCCGGGTGGAGTGGGTGGAAAGCT
GCCCGTTTAATAAAGCGGATGGCGTGCTGAAAGGCACAGAATGCTCAGAGCCAGGTGGTACGAAAACCGG
GGTGATGGAAGGAAAACCCTGGAGCCTGACGGAGGCCTGCTGGGCATACCGCGATAAATATGTCACCCAG
TCTGCGGACAATGGCACCTGCCAGGCGTATGTGGACAATCCGGCCTGTACTCTTGCCACCCGGCAGTGCG
CGTTTTATTCCGGTGAGGGCACCTGCCTGCATGAGTACGCCACGTACTCCTGTGAGTCGAAAACGTCAGG
AAAGGTCATGATTTGTGGCGGGGATGTGTTCTGCCTCGATGGGGAATGCGATAAGGCGCAGAGCGGAAAG
AGCAATGATTTTGGCGAGGCGGTATCGCAACTGGCGGCGCTGGCGGCGGCAGGTAAAGATGTCGCGGCCC
TGAACGGTATTGACGTCCGTGCATTCACCGGACAGGCGAAATTCTGTAAGAAGGCCGCAGCCGGGTACAG
CAACTGCTGTAAGGACAGTGGCTGGGGGCAGGATATCGGTCTGGCTAAATGCAGTAGTGACGAAAAAGCT
CTGGCCAAAGCAAAAACGAACAAACTGACGGTCAGTGTCGGGGAATTCTGTTCGAAAAAGGTACTGGGTG
TCTGTCTGGAGAAGAAACGCAGCTACTGCCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGG
GCGCAACGGCCAACTGCATATCAGCTTCGGCAGTTCAAAACATCCTGACTGCCGGGGTATCACCGTGGAC
GAACTGCAGCAGATTAAATTCGACCAGCTGGACCTCACGAACTTCTACGAAGACCTGATGAATAACCAGA
AAATCCCGGACAGTGGCGCGCTGACGGAGAAGGTGAAAGAACAAATTGCAGACCAACTCAGGCAGGCCGG
GAAATAA
 Primer design