SecReT4
Protein ID: 305696930
T4SS name [ID]Tra_F [82]
Gene symbolTraF
Locus tagpYT1_p102
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]92564..93316 [+]
Productconjugative transfer assembly protein
Component typeTraF_F
UniProt IDD0R7F7, E0D8H9, H3JTA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3e-74, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|305696930|ref|YP_003864245.1| conjugative transfer assembly protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MMRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKSAQVRQEPDIMQKLSALQTATKRALY
EAILYPGVDNFVKYFRLQNYWTQQAGLFSMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAI
SKLAEHYGIMFFYRGQDPIDGQLAQVINGFRATYGLSVIPVTVDGVINPMLPDTRPDQGQAQRLGVKYFP
AMMLVDPKQGSVRPLSYGFITQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|305696832|ref|NC_014476.1|:92564-93316 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGATGCGAAAAATACAGACCGTATGGGTGGCAGCGTTACTCTGTGGCTCCCTGACGGCATACGGAAAAG
ATGCCGGATGGCAGTGGTATAACGACCCGGTAAAATTACCTGACCCAAAAACGACGGATAAATCCGCTCA
GGTTCGTCAGGAGCCTGACATTATGCAGAAATTATCTGCGCTGCAGACCGCAACAAAGCGGGCGCTTTAT
GAAGCCATTCTGTATCCCGGTGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACGCAGC
AGGCGGGGCTTTTCAGCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCTGAACTGGACTATAACCTGCA
GTACAGCCACTACAACGGCACGGTACGTAACCAGCTGGCCGCAGACCAGGCTCAGCAACGGCAGGCCATA
TCAAAGCTGGCTGAACACTACGGTATCATGTTCTTTTACCGCGGGCAGGACCCCATTGACGGCCAGCTGG
CGCAGGTGATTAATGGCTTTCGCGCCACTTACGGTCTGAGCGTTATCCCGGTGACCGTGGACGGGGTGAT
TAACCCGATGCTGCCGGATACGCGTCCTGACCAGGGGCAGGCGCAGCGTCTTGGTGTGAAATATTTCCCG
GCCATGATGCTGGTAGACCCGAAACAGGGCAGTGTCCGTCCGTTGTCATACGGGTTTATTACGCAGGACG
ACCTGGCAAAACAGTTCCTGAATGTGTCAGAAGATTTTAAGCCGAATTTCTAA
 Primer design