SecReT4
Protein ID: 305696931
T4SS name [ID]Tra_F [82]
Gene symbolTraQ
Locus tagpYT1_p103
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]93530..93823 [+]
Productconjugative transfer pilin chaperone protein
Component typeTraQ_F
UniProt IDD0R7F8, H9L4J7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.5e-49, Aligned region: 1..97
Protein Sequence: 97 a.a.     [Download]
>gi|305696931|ref|YP_003864246.1| conjugative transfer pilin chaperone protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MRKYKLSLPLPDITGVWVFSLGVWFHIVGRLVYRKPWMAFFLAELIAIILVLSGAYRVLDAWIARVSREE
RALLEARQAAILAAEKEEKGDKSHVSQ
 
Nucleotide Sequence: 294 bp     [Download]
>gi|305696832|ref|NC_014476.1|:93530-93823 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
GTGCGTAAATATAAATTATCGCTTCCTTTACCGGATATTACTGGAGTATGGGTTTTCTCCCTGGGCGTCT
GGTTTCACATTGTCGGGCGGCTGGTTTACCGCAAACCCTGGATGGCTTTTTTTCTGGCGGAACTGATTGC
CATCATTCTGGTGTTGTCCGGCGCTTACCGGGTGCTGGATGCCTGGATAGCCCGCGTCAGCCGGGAAGAG
CGTGCGTTACTGGAAGCCCGTCAGGCTGCCATTCTGGCTGCTGAAAAAGAAGAAAAGGGGGATAAATCAC
ATGTCTCTCAATAA
 Primer design