SecReT4
Protein ID: 305696933
T4SS name [ID]Tra_F [82]
Gene symbolTraH
Locus tagpYT1_p105
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]94348..95730 [+]
Producttrah pilus assembly protein trah
Component typeTraH_F
UniProt IDH9L4K6, D0R7G0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2e-119, Aligned region: 32..381
Protein Sequence: 460 a.a.     [Download]
>gi|305696933|ref|YP_003864248.1| trah pilus assembly protein trah [Salmonella enterica subsp. enterica serovar Typhimurium]
MQGKTRIKPLFILCTALMTVAPAVSADVNSDMNQFFNKLGFASNTTQPSVWQGQAAGYASGGSLYARTQV
KNVQLVSMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQ
KMASDINSMNLSSCQAAQGIVGGLFPKTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSDSVRDKAS
DKDKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEIMPLPARTTDRAIIRALMEGGT
AKIYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLTSIQNKAVSDTPLDNKEKGFISSTTIPVFKYLV
DPQMLGVSTSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHITDNMNDATRQIASFQAQV
QVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGGAQ
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|305696832|ref|NC_014476.1|:94348-95730 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGCAGGGTAAAACGAGAATTAAACCGCTTTTCATATTATGTACGGCGCTGATGACCGTCGCACCCGCCG
TCTCTGCCGATGTGAACAGCGACATGAACCAGTTCTTCAATAAGCTGGGCTTTGCTTCCAATACCACACA
GCCCTCCGTCTGGCAGGGACAGGCGGCAGGATATGCCTCCGGCGGCTCTTTATATGCCCGGACACAGGTA
AAAAATGTCCAGCTGGTCTCCATGACCCTGCCGGATATCAATGCCGGTTGCGGGGGCATCGATGCCTATC
TCGGCTCATTCAGTTTCATTAACGGCGAGCAGCTGCAGCGTTTTGTGAAGCAGATTATGAGTAACGCCGC
AGGGTACTTTTTTGACCTTGCGCTGCAGACGACGGTGCCGGAAATCAAAACGGCAAAGGATTTTCTGCAG
AAAATGGCCTCCGACATTAACAGTATGAACCTCAGCTCCTGCCAGGCGGCGCAGGGGATTGTCGGGGGGC
TTTTCCCAAAAACACAGGTCTCCCAGCAGAAGGTCTGCCAGGACATTGCCGGTGAGAGCAATATTTTTGC
CGACTGGGCGGCGTCCCGGCAGGGATGTACTGTGGGCGGGCAATCCGACAGCGTCAGGGATAAAGCCAGT
GACAAGGATAAGGAGCGGGTGACCAAAAATATCAACATCATGTGGAATGCTTTGTCCAAAAACAGGATGT
TTGACGGCAACAAGGAGCTGAAAGAGTTCGTGATGACGCTGACCGGTTCACTGGTTTTTGGACCCAACGG
CGAAATCATGCCCCTGCCTGCCAGAACCACCGACCGGGCTATTATCCGGGCATTAATGGAAGGCGGAACG
GCGAAGATATACCACTGCAATGATTCGGATAAATGCCTGAAGGTGGTGGCCGACACGCCGGTGACCATCA
GTCGCGACAATGCGCTCAAATCACAGATTACGAAGCTGCTGACCAGTATTCAGAACAAGGCGGTCAGCGA
CACTCCCCTGGATAATAAGGAAAAAGGGTTTATCTCCAGCACCACCATCCCGGTTTTCAAATACCTGGTT
GACCCGCAGATGCTCGGCGTGTCAACCAGCATGATTTATCAGCTGACGGATTATATCGGGTACGACATCC
TGCTGCAGTATATCCAGGAGCTGATCCAGCAGGCCCGGGCGATGGTGGCCACAGGGAATTATGACGAGGC
GGTTATCGAACATATCACCGACAACATGAATGACGCGACCCGGCAGATAGCGTCCTTCCAGGCGCAGGTC
CAGGTGCAGCAGGATGCGCTGCTGGTTGTCGACCGTCAGATGAGCTACATGCGCCAGCAGCTGTCAGCCC
GCATGCTCAGCCGTTACCAGAACAACTATCATTTTGGCGGAGGTGCGCAGTGA
 Primer design