SecReT4
Protein ID: 305696934
T4SS name [ID]Tra_F [82]
Gene symbolTraG
Locus tagpYT1_p106
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]95727..98549 [+]
Productconjugative transfe: assembly and aggregate stability protein
Component typeTraG_F
UniProt IDH9L4L4, D0R7G1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2e-123, Aligned region: 3..450
Protein Sequence: 940 a.a.     [Download]
>gi|305696934|ref|YP_003864249.1| conjugative transfe: assembly and aggregate stability protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MNEVYVIAGGEWLSNNLNAIAAFMSTRTWDSIEKIALTLSVLAVSVMWVQRHNVMDLLGWVAVFVLISLL
VTIRTSVQIIDNSDLVRVYRVDNVPVGLALPLSLTTRIGHAMVASYEMIFAQPDSVTYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYSLEELMESDDPYTLIFSRPSPLRGVYDKNNHFVTC
KDASVTLKDKLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRELVSDSYSYFYGSSQSASQIMRKNVTMNA
LKEGITSNAARNGDTASLVNLATTSSMEKQRLSHVSIGYVTMRNLPMVQTILLGIAIGIFPLLVLAAVFN
KLTLSVLKGYVFALMWLQTWPLLYAILNSAMVFYAKQNGAPVVLSELSQIQLKYSDLASTAGYLSAMIPP
LSWMMVKGLGAGFSSVYSHFASSSISPTASAAAGVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMTYQT
GSGATATQTRDGNMVMDASGAQSRLPVNINATRQIAAAQQEMAREASTQAESALHGFSSSIASAWNTLSQ
FGTNRGSSDSVTSGADSTMSAQDSIMASRMRSAVESYAKAHNISNEQATQELAARSTRTSGGIYGDASAE
WGIRPKILGVGGGAGVKAGGRAGIDWSDDDTHQASSSSRSSQDVRHGVDAKATQDFKEASDYFTSRKVSE
SGSHTDNNADSRVDHLSAALNSAKQSYDQYTTNLTRSHEYAEMASRTESMSGQMSEDLSQQFVNFVQKHA
PQDAENILTNTSSPEVAERRRAMAWAFVQEQVQPGVDNAWGEARGDIGSGMSTVSGGGDKQDVVADHQAH
QATVEQRTRDSNISNDVKNQVDNMVTDYHSDINDTYGNIQGEEKTIDQQYSGLQKQYKTEALSQNNKYNE
EKAAQERMPGADSPEELMKRAKEYQDKHKQ
 
Nucleotide Sequence: 2823 bp     [Download]
>gi|305696832|ref|NC_014476.1|:95727-98549 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
GTGAACGAAGTCTATGTCATTGCCGGCGGAGAATGGCTGAGTAATAACCTGAACGCCATTGCGGCCTTCA
TGAGCACCCGGACGTGGGACTCCATTGAGAAAATTGCGCTGACCCTGTCCGTTCTCGCGGTGTCCGTTAT
GTGGGTACAGCGACATAACGTGATGGATCTGCTGGGCTGGGTGGCGGTGTTTGTGCTGATATCACTTCTG
GTGACCATACGGACATCAGTACAGATAATTGATAACAGCGACCTGGTGAGGGTTTACCGGGTGGATAATG
TGCCGGTCGGACTGGCACTCCCCCTTTCGCTGACGACCCGGATCGGGCATGCGATGGTGGCCAGCTATGA
GATGATTTTTGCCCAGCCGGACAGCGTCACCTACAGCAAGACAGGTATGCTGTTCGGGGCGAATCTGATT
GTGAAAAGCACCGATTTCCTGTCCCGGAATCCGGAAATCATTAACCTGTTTCAGGACTACGTCCAGAACT
GTGTGCTGGGGGATATTTACCTCAATCACAAATATTCCCTGGAAGAACTGATGGAATCCGATGACCCCTA
TACGCTGATTTTTTCCCGCCCAAGTCCGTTGCGGGGGGTTTATGACAAAAATAATCATTTTGTCACCTGC
AAGGATGCGTCGGTCACGCTGAAAGACAAGCTGAATCTCGATACAAAGACAGGAGGCAAGACCTGGCATT
ATTATGTGCAGCAGATATTTGGGGGCAGGCCGGACCCTGACCTGTTATTCAGGGAACTGGTAAGTGACAG
TTACAGTTATTTCTATGGCTCCAGCCAGTCAGCCAGCCAGATCATGCGTAAGAATGTAACAATGAACGCT
CTGAAAGAAGGGATCACCAGTAATGCAGCCCGTAACGGTGATACCGCCAGTCTGGTGAATCTGGCCACCA
CATCCTCGATGGAAAAACAACGTTTGTCACATGTCTCCATTGGTTATGTGACAATGCGAAACCTGCCGAT
GGTACAGACTATTCTGCTGGGGATAGCCATCGGGATTTTCCCGTTACTGGTTCTGGCCGCTGTCTTTAAT
AAACTGACGCTGTCAGTGCTGAAAGGGTATGTATTTGCCCTGATGTGGCTGCAGACATGGCCGTTGCTGT
ATGCCATTCTGAACAGCGCCATGGTGTTCTATGCGAAACAGAATGGTGCCCCGGTGGTGCTGTCAGAACT
CTCTCAGATACAGCTGAAATATTCCGATCTGGCATCAACCGCAGGTTATCTCTCTGCCATGATTCCCCCG
CTGTCGTGGATGATGGTAAAAGGTCTGGGCGCTGGATTTTCCAGCGTTTACAGCCACTTTGCGTCTTCGT
CTATCAGCCCGACGGCCAGTGCGGCTGCCGGCGTGGTGGACGGCAATTATTCCTACGGCAACATGCAGAC
GGAGAACGTCAACGGCTTCAGCTGGAGTACCAACAGTACCACGTCATTTGGCCAGATGACTTACCAGACC
GGTAGTGGGGCGACCGCCACGCAGACCCGGGACGGCAATATGGTCATGGATGCCAGCGGTGCGCAGTCCA
GACTGCCGGTGAATATCAACGCGACCCGGCAGATAGCGGCGGCACAGCAGGAGATGGCGCGGGAAGCCAG
CACGCAGGCAGAAAGCGCCCTGCATGGTTTCAGCAGCAGTATCGCCAGCGCCTGGAATACGCTCAGCCAG
TTCGGGACGAACCGGGGCAGCAGCGACTCAGTGACCAGTGGTGCTGACAGCACCATGAGCGCGCAGGATT
CCATAATGGCCAGCCGGATGCGCAGCGCAGTGGAAAGCTATGCGAAGGCACATAATATCAGTAATGAGCA
GGCCACTCAGGAACTTGCAGCGAGAAGTACGCGAACATCTGGGGGTATTTATGGTGATGCAAGTGCAGAG
TGGGGCATAAGGCCCAAGATATTGGGGGTCGGTGGTGGAGCTGGTGTTAAAGCCGGTGGTCGTGCTGGTA
TTGATTGGAGCGATGATGATACGCATCAGGCCAGCAGTAGTTCACGATCCAGCCAGGATGTTCGTCATGG
TGTTGATGCCAAAGCCACGCAGGATTTTAAGGAGGCCAGCGATTACTTCACGAGCCGTAAGGTCAGTGAG
TCCGGAAGCCATACGGACAATAATGCTGATTCTCGTGTGGATCATTTGTCTGCCGCCCTGAACTCAGCGA
AACAGAGTTATGACCAGTACACCACGAACCTGACCCGCAGCCATGAGTATGCTGAGATGGCGTCCCGTAC
AGAAAGCATGAGTGGGCAGATGAGCGAAGATTTGTCACAGCAGTTTGTGAATTTTGTGCAAAAGCATGCG
CCACAGGATGCAGAAAATATTCTGACAAATACCAGCTCGCCGGAGGTGGCAGAACGACGTCGGGCAATGG
CTTGGGCCTTTGTTCAGGAGCAGGTACAGCCTGGTGTGGATAATGCCTGGGGCGAAGCCCGCGGTGATAT
TGGCAGTGGTATGAGCACAGTATCCGGTGGTGGTGATAAACAGGATGTGGTAGCCGATCATCAGGCCCAT
CAGGCAACGGTGGAACAACGGACGCGGGACAGTAATATCAGTAATGATGTAAAAAACCAGGTTGATAATA
TGGTCACAGACTATCATTCCGATATAAACGATACTTATGGAAATATCCAGGGTGAGGAAAAGACTATTGA
CCAGCAGTATTCTGGCCTGCAAAAACAGTATAAAACAGAAGCACTATCTCAGAATAATAAATATAATGAA
GAAAAGGCTGCACAGGAAAGGATGCCTGGCGCGGATAGTCCTGAAGAACTGATGAAGAGGGCAAAAGAGT
ATCAGGATAAGCACAAACAGTAA
 Primer design