SecReT4
Protein ID: 305696937
T4SS name [ID]Tra_F [82]
Gene symbolTraD
Locus tagpYT1_p109
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]100203..102365 [+]
Productconjugative transfer DNA transport protein
Component typeTraD_F
UniProt IDE0D8I6, D0R7G4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.1e-143, Aligned region: 172..561
TraD_N [PF12615], Evalue: 2.3e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1.2e-18, Aligned region: 419..541
T4SS-DNA_transf [PF02534], Evalue: 6.4e-10, Aligned region: 394..505
AAA_10 [PF12846], Evalue: 5.4e-07, Aligned region: 398..491
Protein Sequence: 720 a.a.     [Download]
>gi|305696937|ref|YP_003864252.1| conjugative transfer DNA transport protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MSFNAKDMTQGGQIASMRIRMFSQIANIIFYCLFIFFWILVGLVLWVKLSWQTFVNGGIYWWCTTLEGMR
DLIKSQPVYEIRYYGQTFRMNAAQVLQDKYTVWCGEQLWSAFVLAACVALVICLITFFMTTWILGRQGKQ
QSEDDVTGGRQLTDNPKDVARMLKKDGKASDILIGDLPIIKDSEIQNFLLHGTVSTGKSEIIRRLANYAR
QRGDMVVMYDRSCEFVKSYYDPSIDKILNPCDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDSDRSYSKLVDTLLSIKIEKLRTYLRDSPAANLVEEKIEKTAISIRAVLTNYVKA
VRYLQGIERNGEPFTIRDWMRGVREDQKNGWLFISSNADTHSSLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEIVPEARKFGGCYVFGIQSSTQMEDIYGEKAAATLLDVMNTRAFFRSPSYKIA
DYVAHEIGEKEILKASEQYSYGADPVRDGVSTGKEMERVTLVSYSDIQSLPDLTCYVTLPGPYPAVKLAL
KYQERPKVAPEFIPREMNPEAEARLSAVLAAREAEVRQMSSLFEPDTEAVAPTAAEAQAEQPQQPQPTVV
SDKKSAAAGTAVNTPAGGVGQELKMKPEDEEQPLPPGINASGEVVDMAAYERWRQEQEVNTQQQMQRREE
VNINVHRGHGKDEPEPGDDF
 
Nucleotide Sequence: 2163 bp     [Download]
>gi|305696832|ref|NC_014476.1|:100203-102365 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGAGCTTTAATGCGAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATTCGCATGTTCAGTC
AGATCGCCAACATTATATTTTACTGCCTGTTTATTTTCTTCTGGATACTCGTCGGCCTAGTGTTATGGGT
GAAACTCAGCTGGCAGACGTTTGTGAATGGGGGTATCTACTGGTGGTGTACCACGCTTGAAGGAATGCGG
GATTTAATTAAATCCCAGCCTGTCTATGAGATCCGGTATTACGGCCAGACGTTCCGGATGAACGCCGCTC
AGGTTCTGCAGGACAAATACACGGTCTGGTGTGGGGAGCAACTGTGGTCGGCCTTTGTTCTGGCCGCCTG
TGTGGCGCTGGTTATCTGCCTGATTACATTTTTTATGACCACATGGATTCTGGGACGTCAGGGAAAACAG
CAGAGTGAGGATGATGTTACCGGAGGACGCCAACTTACCGACAATCCGAAAGACGTTGCCAGAATGCTGA
AAAAAGACGGAAAAGCGTCCGATATCCTGATTGGCGATTTGCCAATCATTAAGGATTCAGAGATTCAGAA
CTTTTTGCTCCACGGGACAGTCAGTACCGGTAAGTCTGAAATCATTCGCCGGCTGGCTAACTATGCCCGT
CAGCGCGGCGACATGGTGGTGATGTACGATCGTTCCTGTGAGTTTGTCAAAAGCTACTACGACCCGTCCA
TCGATAAAATTCTCAACCCCTGTGACGCGCGGTGTGCCGCATGGGATTTATGGCGGGAATGCCTCACCCT
GCCGGATTTTGATAATGCGGCGAATACCCTGATCCCGATGGGCACGAAGGAAGATCCGTTCTGGCAGGGT
TCCGGACGGACCATTTTTGCTGAAGCGGCATACCTGATGCGTAATGACAGCGACCGCAGCTACAGTAAGC
TGGTTGACACGCTGCTTTCAATCAAGATTGAAAAACTGCGAACCTACCTGCGTGATTCCCCGGCGGCCAA
CCTGGTGGAAGAAAAAATCGAGAAGACGGCCATTTCCATCCGGGCTGTGCTGACCAACTACGTAAAAGCC
GTCCGCTATCTTCAGGGGATCGAGCGTAACGGTGAACCGTTCACCATCCGTGACTGGATGCGTGGTGTAC
GTGAAGATCAGAAGAATGGCTGGCTGTTTATTTCTTCAAACGCTGACACACATTCTTCCCTGAAGCCGGT
GATTTCCATGTGGCTGTCCATTGCCATCCGGGGCCTGCTGGCGATGGGAGAGAACCGTAACCGTCGGGTG
TGGTTCTTCTGTGATGAGTTGCCCACGCTGCACAAGCTGCCCGACCTCGTGGAAATTGTCCCGGAAGCCC
GTAAATTCGGGGGCTGCTATGTCTTTGGTATTCAGTCCAGTACACAGATGGAGGATATCTATGGCGAGAA
AGCGGCGGCAACCCTGCTGGATGTGATGAACACAAGGGCCTTTTTCCGCTCACCCAGCTATAAGATTGCC
GACTATGTCGCCCATGAGATTGGTGAAAAAGAGATCCTGAAAGCCAGTGAGCAGTATTCCTATGGTGCCG
ATCCCGTTCGTGACGGGGTGTCGACCGGTAAAGAGATGGAGCGTGTCACACTGGTCAGCTACTCCGATAT
TCAGTCACTGCCCGACCTGACCTGTTATGTCACGCTGCCCGGACCCTATCCGGCAGTGAAGCTGGCCCTG
AAATACCAGGAACGTCCCAAAGTGGCGCCGGAGTTTATTCCCCGGGAAATGAATCCGGAGGCGGAAGCCC
GTCTGAGCGCCGTTCTGGCTGCAAGGGAAGCCGAGGTACGTCAGATGTCCAGCCTGTTTGAACCGGATAC
AGAAGCGGTTGCGCCGACAGCAGCAGAAGCGCAGGCTGAACAGCCGCAACAGCCACAGCCCACGGTTGTC
AGCGATAAAAAATCAGCAGCGGCGGGTACCGCCGTGAATACGCCTGCAGGCGGTGTCGGACAGGAACTGA
AAATGAAGCCGGAAGACGAAGAGCAGCCACTGCCCCCCGGGATTAATGCGTCCGGTGAGGTGGTGGACAT
GGCGGCGTATGAGCGCTGGCGGCAGGAGCAGGAGGTGAATACTCAGCAGCAGATGCAACGGCGGGAGGAG
GTGAATATCAACGTTCACCGTGGGCACGGAAAGGATGAACCGGAGCCGGGAGATGATTTCTGA
 Primer design