SecReT4
Protein ID: 305696939
T4SS name [ID]Tra_F [82]
Gene symbolTraI
Locus tagpYT1_p111
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]103081..108339 [+]
Productconjugative transfer oriT nicking-unwinding protein
Component typeTraI_F
UniProt IDD0R7G6, H9L4G8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 1.4e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 1.2e-57, Aligned region: 1430..1556
AAA_30 [PF13604], Evalue: 4.7e-42, Aligned region: 967..1160
UvrD_C_2 [PF13538], Evalue: 7.1e-06, Aligned region: 1337..1440
AAA_19 [PF13245], Evalue: 1.8e-05, Aligned region: 980..1046
Protein Sequence: 1752 a.a.     [Download]
>gi|305696939|ref|YP_003864254.1| conjugative transfer oriT nicking-unwinding protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MMSIAQVRSAGSAAGYYSDRDNYYVLGSMEERWAGKGAEQLGLQGTVDKEVFTRVLEGRLPDGADLSRQQ
DGGNKHRPGYDLTFSAPKSVSLMAMLAGDKRLTEAHNQAVDIAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVVNVTQHDGEWKTLSSDKVGKTGFIENVYANQIAFGKIYRAVLKEKVEA
LGYETEVVGKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVKMAEWMQT
LKDTGFDISAYRESADRRAEIQAAQPVPSQEQPDIQQAVTQAIAGLSDRKVQFTYTDVLARTVGMLPPEA
GVIEKARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSSDIMKQNRVTVHPEKSVPRTGSYSD
AVSVLAQDRPSLAIISGQGGAAGQRERVAELTMMAREQGREVQIIVADRRSQTNLKQDERLSGELITGRR
QLQEGMLFSPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKEAGVNSYRWQ
GRQQTPATVISEPDRNVRYARLAGDFVAAVKAGEESVAQVSGMREQAILAGMIRSELKTQGILGQQDTMM
TALSPVWLDSRNRYLRDMYREGMVMEQWNPEKRSHDRYVIDRVTAQSHSLTLRDAQGETQMVRISALDSS
WSLFRPEKMPVADGERLMVTGKIPGLRVSVGDRLQVSAVNDGVMTVTVPGRAEPASLPVGDSPFTALKLE
NGWVETPGHSVSDSAKVFASVTQMAMDNATLNSLARSGRDVRLYSSLDETRTAEKLSRHPSFTVVSEQIK
ARAGEVSLETAISRQKAGLHTPAQQAIHLALPVVESKNLAFSQVDLLTEAKSFAAEGTGFADLGREIDAQ
IKRGDLLYVDVAKGYGTDLLISRASYDAEKSILHHILEGKEAVTPLMERVPGELMETLTSGQRAATRMIL
ETKDRFTVVQGYAGVGKTTQFRAVMSAVNLLPESERPRVVGLGPTHRAVGEMRSAGVEAQTLASFLHDTQ
LQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAA
DVAIMKEIVRQTPELRDAVYSLINRDVNKALSGLENVKPVQVPRLKGAWAPENSVTEFSRLQERELAKAA
QEAEKKGEAFPDVPVTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIQDALAKPGEQQVTVPVL
TTANIRDGELRRLSTWEAHPGALALVDNVYHRIAGISKEDGLITLEDKAGNTRLISPREAAAEGVTLYNP
ETIRVGAGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGKQTRVVRPGQDRAEQHIDLAYAITAHS
AQGASETFAIALEGTEGGRKQMAGFESAYVALSRMKQHVQVYTDDRQGWVKAINSAEQKGTAHDVLEPKS
EREMMNAERLFSTARELRDVAAGRAVLRNAGLAQGDSRARFIAPGRKYPQPYVALPAFDRNGKSAGIWLN
PLTTDDGAGLRGFTGEGRVKGSEEAQFVALQGSRNGESLLAGSMQDGVRIARENPDSGVVVRIVGDGRPW
NPVAITGGRVWGDIPDSNVQPGAGNGEPVTAEILAQRQAEEAVRRETERRADEIVRKMAEDKSDLPEEKT
AQAVREIAGQEQDRMTPPEREPPLPESVLREPQRERETIREVARENRGRERLQQMEQEMVRDLQKEKTPG
GD
 
Nucleotide Sequence: 5259 bp     [Download]
>gi|305696832|ref|NC_014476.1|:103081-108339 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGATGAGTATTGCGCAGGTCCGGTCGGCGGGAAGTGCCGCCGGTTATTACAGCGACAGGGATAACTACT
ACGTGCTGGGCAGCATGGAAGAGCGCTGGGCCGGAAAAGGCGCGGAGCAGCTGGGGTTGCAGGGCACCGT
CGATAAGGAGGTGTTCACCCGGGTACTGGAAGGCAGACTGCCCGACGGGGCTGATCTGAGCCGGCAGCAG
GATGGCGGCAACAAACACCGCCCCGGCTATGATCTGACCTTCTCTGCCCCCAAAAGTGTTTCCCTGATGG
CCATGCTGGCCGGTGATAAACGCCTGACTGAGGCACACAACCAGGCGGTGGATATCGCTGTCCGTCAGGT
GGAGGCGCTGGCCTCCACCAGGGTGATGACGGACGGACAGTCAGAAACGGTGCTCACCGGTAATCTGGTG
ATGGCGCTGTTCAATCATGACACCAGTCGTGACCAGGAGCCGCAGTTGCATACCCATGCTGTGGTGGTCA
ACGTCACGCAGCATGACGGGGAATGGAAGACCCTGAGCAGCGATAAGGTGGGCAAAACGGGATTTATCGA
GAATGTCTATGCTAACCAGATAGCCTTCGGGAAGATTTACCGCGCGGTGCTGAAAGAGAAGGTTGAAGCG
CTGGGCTATGAAACGGAAGTGGTCGGTAAGCACGGTATGTGGGAGATGCCCGGTGTCCCGGTGGAGGCCT
TTTCCAGCCGTTCGCAGGCCATCCGAGAGGCGGTCGGGGAGGATGCCTCGCTGAAATCCCGGGATGTGGC
GGCGCTGGATACGCGTAAATCCAAACAGCATGTCGATCCGGAAGTGAAAATGGCTGAGTGGATGCAGACC
CTGAAAGATACCGGGTTTGATATCAGCGCATACCGTGAGTCTGCGGACAGGCGGGCGGAAATACAGGCAG
CACAGCCTGTTCCGTCACAGGAGCAGCCGGATATTCAGCAGGCGGTGACGCAGGCCATTGCCGGATTAAG
CGACCGGAAGGTTCAGTTTACGTATACCGACGTGCTGGCCAGAACGGTCGGCATGCTGCCGCCGGAAGCC
GGCGTGATTGAGAAAGCCCGGGCCGGGATTGATGAGGCCATCAGCCGCGAGCAGCTTATCCCCCTCGACC
GGGAGAAAGGACTGTTCACCTCCGGTATTCATGTGCTCGATGAGCTGTCTGTCCGGGCACTCAGCAGCGA
TATCATGAAGCAGAACCGGGTGACCGTCCATCCGGAGAAGAGCGTGCCCCGCACGGGAAGTTACAGCGAC
GCGGTGAGTGTCCTGGCTCAGGACCGCCCGTCACTGGCCATTATCAGTGGTCAGGGCGGTGCTGCCGGTC
AGCGGGAGCGGGTGGCGGAACTGACGATGATGGCCCGGGAGCAGGGGCGTGAGGTGCAGATTATTGTCGC
TGACCGCCGTTCGCAGACAAACCTGAAGCAGGATGAACGTCTGTCCGGTGAGCTGATAACCGGGCGTCGT
CAGTTGCAGGAGGGCATGTTATTTTCCCCGGGCAGTACCGTTATTGTCGACCAGGGGGAAAAGCTGTCCC
TGAAGGAGACTCTGACCCTGCTGGATGGCGCGGCGCGTCATAACGTCCAGGTGCTAATTACCGACAGCGG
TCAGCGCACCGGTACCGGCAGCGCGCTGATGGCCATGAAGGAGGCCGGCGTGAACAGTTACCGCTGGCAG
GGCAGGCAGCAGACCCCGGCGACCGTTATCAGCGAGCCGGACCGGAATGTCCGCTATGCCCGGCTGGCCG
GGGATTTTGTGGCTGCGGTGAAAGCCGGGGAAGAGAGCGTGGCACAGGTCAGCGGCATGCGTGAACAGGC
CATACTGGCGGGGATGATACGCAGTGAGCTGAAGACGCAGGGGATACTCGGGCAGCAGGACACCATGATG
ACCGCCCTGTCACCGGTCTGGCTGGACAGCCGGAACCGTTACCTGCGCGATATGTACCGTGAAGGGATGG
TGATGGAGCAGTGGAACCCGGAGAAACGGTCCCATGACCGGTATGTGATTGACCGGGTGACCGCACAAAG
TCACAGTCTGACCCTGCGGGATGCGCAGGGAGAGACGCAGATGGTGCGGATTTCAGCCCTGGACAGCAGT
TGGTCACTCTTCCGACCGGAGAAGATGCCGGTGGCAGACGGTGAGCGTCTTATGGTGACGGGAAAAATTC
CCGGGCTTCGCGTCTCCGTCGGCGACCGGCTGCAGGTATCTGCGGTGAACGATGGCGTGATGACGGTGAC
GGTACCCGGCAGGGCTGAACCGGCTTCCCTGCCGGTGGGGGATTCCCCGTTCACGGCGCTGAAGCTGGAA
AACGGCTGGGTGGAAACACCCGGGCATTCCGTCAGTGACAGTGCGAAAGTTTTTGCTTCCGTCACACAGA
TGGCGATGGACAACGCCACCCTGAACAGTCTGGCCCGCAGCGGCCGGGATGTCCGGCTGTATTCCTCACT
GGATGAGACCCGCACTGCTGAAAAACTCTCCCGTCACCCGTCTTTTACGGTCGTTTCTGAGCAGATAAAG
GCGCGTGCCGGTGAGGTATCGCTGGAAACCGCCATCAGCCGCCAGAAAGCCGGGCTTCACACGCCGGCAC
AGCAGGCCATTCACCTTGCCCTTCCGGTGGTGGAAAGTAAAAACCTGGCATTCAGTCAGGTGGACCTGCT
GACGGAGGCGAAGTCGTTTGCTGCAGAGGGAACCGGTTTTGCTGACCTGGGACGGGAAATTGATGCGCAG
ATAAAACGGGGCGATTTACTGTATGTGGATGTGGCAAAAGGTTATGGCACAGACCTGCTGATTTCCCGTG
CGTCGTATGACGCTGAAAAGAGTATTCTGCATCATATCCTTGAGGGCAAGGAGGCGGTCACGCCACTGAT
GGAGAGGGTACCCGGCGAACTCATGGAGACTCTGACATCCGGACAGCGTGCCGCCACCCGTATGATACTC
GAAACGAAAGACCGTTTCACCGTGGTACAGGGTTATGCCGGGGTGGGCAAGACCACCCAGTTCCGGGCGG
TGATGTCAGCGGTGAACCTGCTGCCGGAGAGTGAGCGTCCCCGCGTCGTGGGGCTGGGACCGACCCACAG
GGCGGTCGGGGAGATGCGCAGTGCCGGCGTGGAAGCACAGACGCTGGCGTCCTTTCTGCACGACACGCAA
CTGCAGCAGCGCAGCGGTGAAACGCCGGATTTCAGCAACACACTGTTCCTCCTTGATGAGAGTTCGATGG
TGGGCAACACCGATATGGCGCGGGCATACGCCCTGATTGCGGCCGGTGGTGGTCGTGCCGTGGCGAGCGG
TGACACGGACCAGCTGCAGGCCATCGCACCCGGCCAGCCTTTCCGCCTGCAGCAGACGCGCAGCGCGGCT
GATGTGGCCATCATGAAGGAGATTGTACGCCAGACACCGGAACTGCGGGACGCCGTGTACAGCCTGATTA
ACCGGGATGTGAATAAGGCACTGTCCGGGCTTGAAAACGTGAAGCCGGTTCAGGTTCCCCGCCTGAAGGG
GGCATGGGCGCCGGAAAACTCGGTGACGGAGTTCAGCCGTCTGCAGGAGCGGGAACTGGCGAAAGCCGCA
CAGGAGGCGGAGAAAAAGGGCGAAGCCTTTCCGGATGTGCCCGTGACGCTGTATGAGGCCATTGTCCGCG
ACTATACCGGCAGAACGCCGGAAGCCCGGGAGCAGACGCTGATTGTCACGCATCTGAATGAGGACCGTCG
GGTGCTGAACAGCATGATTCAGGATGCGCTGGCGAAACCGGGTGAGCAGCAGGTCACTGTCCCTGTACTG
ACCACCGCGAATATCCGTGACGGGGAACTGCGCCGTCTGTCCACCTGGGAGGCGCATCCGGGGGCGCTGG
CCCTGGTGGATAATGTGTATCACCGGATTGCCGGTATCAGTAAGGAGGACGGGCTGATTACCCTGGAAGA
TAAGGCGGGTAACACCCGCCTTATTTCCCCCCGGGAAGCAGCGGCAGAGGGCGTCACACTATACAATCCG
GAAACTATCCGGGTGGGGGCCGGTGACCGGATGCGTTTCACGAAGAGTGACAGGGAACGCGGGTATGTAG
CCAACAGCGTCTGGACGGTGACGGCGGTTTCCGGTGACAGCGTCACGCTGTCAGACGGGAAACAGACCCG
CGTGGTGCGTCCCGGGCAGGACAGGGCAGAGCAACATATTGACCTGGCGTATGCCATCACCGCCCACAGT
GCGCAGGGGGCCAGTGAGACGTTTGCCATTGCGCTGGAGGGAACCGAAGGGGGCCGGAAACAGATGGCCG
GTTTTGAGTCGGCGTATGTGGCGCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACACCGACGACCGTCA
GGGTTGGGTTAAGGCCATCAACAGTGCGGAGCAAAAGGGCACGGCCCATGACGTGCTGGAGCCTAAATCA
GAGCGTGAGATGATGAACGCAGAGCGCCTGTTCAGCACCGCCCGGGAACTGCGGGACGTGGCCGCCGGCC
GTGCCGTGCTGCGCAACGCCGGACTGGCGCAGGGAGACAGCCGGGCGCGTTTTATTGCACCGGGGCGCAA
GTATCCGCAGCCGTATGTGGCGCTGCCGGCGTTTGACCGTAACGGTAAATCCGCCGGTATCTGGCTGAAC
CCGCTGACAACGGATGACGGTGCCGGGCTGCGGGGATTCACCGGGGAAGGTCGGGTGAAAGGCAGTGAAG
AGGCGCAGTTTGTGGCCCTGCAGGGCAGTCGTAACGGCGAAAGCCTGCTGGCTGGTAGCATGCAGGATGG
CGTCCGGATTGCCCGGGAGAACCCCGACAGCGGCGTGGTGGTGCGAATTGTCGGTGACGGGCGTCCATGG
AATCCCGTCGCCATTACCGGCGGCAGGGTGTGGGGCGATATTCCTGACAGTAACGTGCAGCCCGGCGCGG
GGAACGGGGAGCCGGTCACGGCAGAGATTCTGGCACAGCGGCAGGCAGAAGAGGCAGTCCGCCGTGAAAC
AGAACGCCGTGCGGATGAGATTGTCCGTAAAATGGCTGAGGACAAATCTGACCTGCCGGAGGAGAAAACC
GCGCAGGCGGTCAGGGAGATTGCCGGCCAGGAGCAGGACAGAATGACCCCGCCTGAACGGGAACCCCCGC
TGCCGGAGAGTGTGCTGCGCGAACCACAAAGGGAGCGGGAGACCATCCGGGAAGTGGCGCGGGAAAACCG
GGGCCGGGAGCGGCTGCAGCAGATGGAGCAGGAGATGGTGCGTGACCTGCAGAAAGAGAAAACCCCTGGC
GGGGACTGA
 Primer design