SecReT4
Protein ID: 305696942
T4SS name [ID]Tra_F [82]
Gene symbolTraX
Locus tagpYT1_p114
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 (NC_014476)
Repliconplasmid pYT1 [GenBank: NC_014476] [Browse all T4SS(s) in this replicon]
Location [Strand]108359..109099 [+]
Productconjugative transfer fimbrial acetylation protein
Component typeTraX_F
UniProt IDH9L4E6, D0R7G7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.3e-49, Aligned region: 30..245
Protein Sequence: 246 a.a.     [Download]
>gi|305696942|ref|YP_003864257.1| conjugative transfer fimbrial acetylation protein [Salmonella enterica subsp. enterica serovar Typhimurium]
MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFLAGRGAFPLFA
LVWGLNLSQHTHIRQSAINRLWGWAVIAQSGYFLAGFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAAL
LLLTAWIPLSGTSYGVAGVLVLVICYRLYRTTDTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLT
VWLVSLTGKSRPRFWPADFFPVFYTCHLAALGVLAM
 
Nucleotide Sequence: 741 bp     [Download]
>gi|305696832|ref|NC_014476.1|:108359-109099 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1, complete sequence
ATGACGATGGATAACGCCACACGTAACGATTCGCGGGCAGTCCGGGTGGATACCCGGCTGCAGCGACTGC
TGGCCTGGTCGCCGGGACAGAGAGATCTCATCAAAACCGTGGCGCTGCTGCTGATGGTGGCTGACCATAT
TAACCGTATCCTGCACCTGAACCAAGAGTGGCTGTTTCTGGCCGGGCGCGGGGCGTTTCCGCTGTTTGCC
CTGGTGTGGGGGCTGAACCTGTCCCAGCATACGCATATCCGCCAGTCTGCGATTAACCGGCTGTGGGGAT
GGGCGGTTATCGCGCAGTCCGGATATTTTCTGGCGGGATTTCCGTGGTATGAAGGGAATATTCTGTTTGC
CTTTGCGGTGACCGCGCAGGCGCTGAAGTGGTGTGAGCAGCGCTGCCTGTTTCACTCTGCGGCCGCGCTG
TTACTGCTGACGGCGTGGATACCCCTGTCCGGAACCAGCTACGGCGTTGCCGGCGTGCTGGTGCTGGTCA
TCTGTTACCGGCTGTACCGGACCACAGATACTGAAGAACATCTGGCGCTTGCGGCCTGCCTAGTGGTGGC
CGTCCCCGCGCTGAATCTGGTTACCAGTGATGCCGCGGCGGTGGCAGGACTTCTGGTGACCGGGCTGACG
GTATGGCTTGTTTCGCTGACAGGCAAATCACGGCCCCGGTTCTGGCCGGCTGATTTTTTCCCGGTATTCT
ACACCTGCCATCTGGCTGCCCTGGGCGTTCTGGCGATGTGA
 Primer design