SecReT4
Protein ID: 307129585
T4SS name [ID]Trb [319]
Gene symbol-
Locus tagDda3937_01739
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T4SS(s) in this replicon]
Location [Strand]893527..893874 [+]
ProductConjugative transfer protein TrbC
Component typeTrbC
UniProt IDE0SAI6
KEGG IDddd:Dda3937_01739
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-23, Aligned region: 13..105
Protein Sequence: 115 a.a.     [Download]
>gi|307129585|ref|YP_003881601.1| unnamed protein product [Dickeya dadantii 3937]
MMLPFALRFSDCWLVRRSLPGAALAVSLLWGLTAYASGSSMPWESPLQSILESIQGPVARIIAVIIIITT
GLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFAGGAVV
 
Nucleotide Sequence: 348 bp     [Download]
>gi|307128764|ref|NC_014500.1|:893527-893874 Dickeya dadantii 3937 chromosome, complete genome
ATGATGCTCCCGTTTGCTCTTCGCTTTTCCGACTGCTGGCTCGTTCGACGTAGTCTGCCTGGAGCCGCAC
TGGCCGTCAGCCTGTTGTGGGGGCTGACGGCCTACGCCAGTGGCTCAAGTATGCCGTGGGAGTCGCCGCT
GCAGTCGATCCTGGAATCCATACAAGGGCCGGTGGCGCGCATTATCGCGGTCATCATCATTATCACCACC
GGGCTGGCGCTGGCCTTTGGCGATACCTCGGGTGGATTTCGCAAGCTGATCCAGATCGTGTTTGGGCTGT
CGATTGCCTTTGCCGCCTCCTCGTTCTTTTTGTCGTTTTTCAGCTTTGCCGGCGGGGCAGTGGTATGA
 Primer design