SecReT4
Protein ID: 307129589
T4SS name [ID]Trb [319]
Gene symbol-
Locus tagDda3937_01743
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T4SS(s) in this replicon]
Location [Strand]897332..898498 [+]
ProductConjugative transfer protein TrbL
Component typeTrbL
UniProt IDE0SAJ0
KEGG IDddd:Dda3937_01743
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.1e-45, Aligned region: 39..265
Protein Sequence: 388 a.a.     [Download]
>gi|307129589|ref|YP_003881605.1| unnamed protein product [Dickeya dadantii 3937]
MMDDVSVIDRFLDTFSTYIDSGFGLVRGEVSFLTATLVAIDMTLAGLYWALSQAGGQGEDVMARLIRKVL
YVGAFAYILNNFNGLAGIVFRSFAGLGLQAGGAALSLATFLQPGRLAKTGIDTAAPLLHQIDRLSGFPDV
FINIVPVTVMLLAWLVVVLSFFALAIQLFVTLVEFRLTTLAGFVLVPFALWNKTAFLAEKVLGNVVASGV
KVLVLAVIVGIGTGLFGSLALSQDDPSLDQALVAMLASLALLALGIFGPGIATGLVSGAPQLGAGALAGT
ALGVAGVAAGTSALAGRVGSAVGAGARLLPAALRGPQANTTSSATGQPGREAGSSGSSATAQPDWAKRLY
RRQQLAQAAGTVAHTLRSAEHGGGSSGPTLRESDREGG
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|307128764|ref|NC_014500.1|:897332-898498 Dickeya dadantii 3937 chromosome, complete genome
GTGATGGACGATGTGTCGGTGATTGACCGCTTCCTCGATACCTTTTCGACCTACATCGACTCTGGGTTTG
GGTTGGTTCGCGGTGAAGTCTCCTTTCTGACCGCCACGCTGGTGGCGATCGACATGACGCTGGCGGGGTT
GTACTGGGCGCTGTCGCAGGCGGGCGGGCAGGGAGAGGATGTGATGGCACGGCTGATCCGCAAGGTGCTC
TATGTCGGCGCGTTTGCTTACATACTCAACAACTTCAACGGGCTGGCGGGCATAGTATTTCGCTCATTTG
CCGGGCTGGGCCTGCAGGCCGGTGGCGCGGCGCTGAGTCTGGCTACGTTTCTGCAGCCCGGGCGGTTAGC
TAAAACCGGTATAGATACGGCCGCCCCTCTGCTGCATCAAATCGACCGCCTGAGTGGCTTCCCAGATGTG
TTCATCAATATTGTGCCCGTCACCGTCATGCTGCTGGCTTGGTTGGTGGTGGTACTGAGTTTCTTCGCAC
TGGCGATACAACTGTTCGTCACGTTGGTGGAGTTCCGGCTGACCACACTGGCGGGGTTTGTGCTGGTGCC
GTTTGCACTGTGGAACAAGACGGCGTTTCTGGCAGAGAAAGTGCTGGGCAATGTGGTGGCTTCCGGTGTG
AAGGTGCTGGTACTGGCGGTGATCGTGGGGATCGGCACTGGTCTGTTCGGTTCGCTGGCCCTGAGTCAGG
ATGACCCCTCGTTGGATCAGGCGCTGGTCGCCATGCTGGCGTCGCTTGCACTGTTGGCGCTGGGGATTTT
CGGACCTGGCATTGCCACTGGGTTGGTGAGCGGCGCGCCGCAACTGGGGGCCGGGGCGTTGGCCGGAACG
GCGTTGGGAGTAGCTGGCGTCGCGGCGGGAACCAGCGCGCTGGCGGGGCGGGTAGGTAGTGCGGTGGGGG
CCGGGGCACGTCTGCTGCCGGCGGCGTTACGCGGGCCACAAGCCAATACGACCTCGTCGGCTACCGGACA
ACCGGGGCGGGAGGCCGGTTCATCCGGTTCGTCAGCCACGGCACAGCCGGACTGGGCGAAGCGGCTATAT
CGCCGTCAGCAACTGGCGCAGGCGGCGGGCACGGTGGCGCATACGCTGCGCAGTGCCGAGCACGGGGGCG
GCAGCAGCGGCCCGACTCTGCGTGAATCCGACCGGGAAGGGGGATGA
 Primer design