SecReT4
Protein ID: 307129591
T4SS name [ID]Trb [319]
Gene symbol-
Locus tagDda3937_01745
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T4SS(s) in this replicon]
Location [Strand]899163..900098 [+]
ProductConjugative transfer protein TrbG
Component typeTrbG
UniProt IDE0SAJ2
KEGG IDddd:Dda3937_01745
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.1e-59, Aligned region: 94..305
Protein Sequence: 311 a.a.     [Download]
>gi|307129591|ref|YP_003881607.1| unnamed protein product [Dickeya dadantii 3937]
MEPGTDDAGRRSAMRTWWYYGPACYLILALTGCRGMGNRPPVVDLDEPAPTASVPMPPASIVMGKGENGV
PERMGGELSGGNTGRAADSRDLSSWRYAEGTMYRLYTAPERVTVIALQPGETLTNVAAGDTTRWIVGDTT
SGSGSEQRVNIMVKPVRAGLKTNLVITTSRRVYLLLMTSGGTRWMATVSWLYPADPASIPSPATSLRSPE
SALAPGRLHFRYAISGDRPPWRPRLVFDDGEKVYIRFPAGIAQGELPPLFVIGPQGDGQLVNYRFQPPYY
VVDRLFGAAELRLGNGSAQVVRITRTDGRSP
 
Nucleotide Sequence: 936 bp     [Download]
>gi|307128764|ref|NC_014500.1|:899163-900098 Dickeya dadantii 3937 chromosome, complete genome
GTGGAGCCGGGAACTGACGATGCCGGAAGGCGGTCAGCCATGAGAACGTGGTGGTATTACGGTCCTGCCT
GTTACCTGATACTGGCGCTGACCGGCTGTCGCGGTATGGGAAACCGGCCACCGGTTGTCGATCTGGACGA
GCCGGCTCCGACAGCCTCGGTTCCTATGCCTCCGGCCTCCATAGTGATGGGGAAGGGGGAGAATGGAGTG
CCTGAACGAATGGGGGGCGAACTGTCGGGTGGTAATACCGGGCGCGCCGCGGATAGCCGCGACCTGTCGT
CCTGGCGCTACGCCGAGGGGACGATGTATCGGCTTTATACGGCACCGGAGCGCGTCACCGTGATTGCCCT
GCAACCGGGGGAAACACTGACAAATGTGGCGGCCGGTGATACGACTCGCTGGATTGTCGGTGATACCACC
AGCGGCTCGGGCAGCGAACAGCGCGTCAATATCATGGTCAAGCCGGTGCGGGCCGGGCTGAAAACCAACC
TGGTGATCACCACCAGCCGGCGGGTTTATCTGTTGCTGATGACCTCTGGCGGGACGCGCTGGATGGCGAC
GGTGTCATGGCTGTACCCAGCCGATCCGGCGTCGATACCCTCACCAGCCACATCGCTCCGGTCACCGGAA
AGCGCACTGGCACCGGGCAGGCTCCACTTTCGTTACGCCATCAGCGGTGATCGCCCGCCGTGGCGACCCC
GACTGGTGTTTGATGACGGGGAAAAGGTCTATATCCGGTTTCCGGCCGGTATCGCGCAGGGTGAACTGCC
GCCGCTGTTCGTCATCGGCCCGCAGGGGGACGGACAACTGGTGAATTACCGGTTCCAGCCGCCGTACTAT
GTGGTGGACCGGTTGTTCGGGGCGGCCGAGCTGCGGCTGGGCAATGGCAGTGCCCAGGTGGTGCGCATTA
CGCGCACCGACGGACGGAGCCCGTGA
 Primer design