SecReT4
Protein ID: 307546636
T4SS name [ID]Tfc [722]
Gene symbol-
Locus tagHELO_4046
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T4SS(s) in this replicon]
Location [Strand]3573690..3574481 [+]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDE1VA42
KEGG IDhel:HELO_4046
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 263 a.a.     [Download]
>gi|307546636|ref|YP_003899115.1| unnamed protein product [Halomonas elongata DSM 2581]
MRCHASCLEGKTMRWGWISGLAMAVGLSGTAQASEIPPAYHVAAASQGVPAEVLYAIAMTESKMSLGEAI
RPWPWTLNVGGKGYRYDSRDEACQALRRFLQDTRVVDVGIAQMNVRWQTVFHAGGRFQNPCDGLNPYANL
EEAAAVLQAQYQIAGDWVQAAGRYHRPAGGAPAARYRRKVAEELAKLEGGQDLSPALAATSTATSASAAS
TSTASALGTAAATLTPDPDPDLVWRDPAPAEVTWVTPSMPDWHTQAQLEVAAR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|307543589|ref|NC_014532.1|:3573690-3574481 Halomonas elongata DSM 2581 chromosome, complete genome
ATGCGCTGCCACGCGTCATGCCTCGAGGGTAAGACCATGCGATGGGGATGGATCAGCGGTCTGGCAATGG
CCGTCGGCCTCAGCGGAACGGCCCAGGCGAGCGAGATACCGCCAGCGTATCACGTCGCCGCCGCCTCGCA
AGGCGTGCCCGCCGAGGTGTTGTACGCCATCGCCATGACCGAGTCGAAGATGTCCCTGGGCGAGGCCATT
CGCCCCTGGCCCTGGACGCTCAATGTCGGTGGTAAGGGCTATCGCTATGACAGCCGTGATGAAGCCTGTC
AGGCGCTGCGTCGCTTCCTGCAGGACACCCGCGTGGTCGATGTCGGTATCGCCCAGATGAACGTGCGCTG
GCAGACCGTTTTCCACGCCGGCGGTCGCTTCCAGAACCCCTGCGATGGGCTGAACCCCTACGCCAATCTC
GAAGAGGCGGCCGCCGTGCTCCAGGCGCAGTACCAGATTGCCGGTGACTGGGTGCAGGCCGCTGGCCGCT
ATCACCGGCCGGCCGGGGGCGCCCCGGCCGCCCGGTATCGCCGCAAAGTGGCCGAAGAGCTCGCCAAGCT
GGAGGGCGGCCAGGATCTCTCGCCGGCGCTTGCTGCCACATCAACCGCCACCTCGGCCTCAGCAGCCTCG
ACATCGACGGCATCCGCCTTGGGCACCGCTGCAGCGACACTGACGCCGGATCCGGATCCGGATCTGGTCT
GGCGGGATCCGGCACCGGCCGAAGTCACCTGGGTCACCCCGTCGATGCCTGACTGGCATACCCAGGCCCA
ACTGGAGGTCGCTGCCCGATGA
 Primer design