SecReT4
Protein ID: 307546641
T4SS name [ID]Tfc [722]
Gene symbol-
Locus tagHELO_4051
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T4SS(s) in this replicon]
Location [Strand]3579425..3580123 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDE1VA47
KEGG IDhel:HELO_4051
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.3e-59, Aligned region: 50..229
Protein Sequence: 232 a.a.     [Download]
>gi|307546641|ref|YP_003899120.1| unnamed protein product [Halomonas elongata DSM 2581]
MAVDRAERAQQKRPSALGTLLGLPWRIAMVVLVSLLCSIVIEWVGMYWDWWSLPGSGHAEQTMTTEMGWL
DTQFTRSLLFADPVATASALVEWLHTWLFVKTGIAGWLDHNETTGGWVGTLHTYLEAAVYVTLMTLTRCV
ILVLTSPLFVMAALVGFIDGLVRRDLRRFGAGRESAFIYHHAKRAVTPIFILGWLVYLSVPFSFHPNVFL
LPCAVLFGLMISIATGSFKKYL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|307543589|ref|NC_014532.1|:3579425-3580123 Halomonas elongata DSM 2581 chromosome, complete genome
ATGGCGGTTGATCGCGCCGAACGCGCCCAGCAAAAACGTCCTAGTGCTCTCGGCACGCTGCTCGGCTTGC
CGTGGCGGATCGCCATGGTGGTCCTGGTGTCCCTGCTGTGCTCGATCGTCATCGAGTGGGTCGGGATGTA
TTGGGACTGGTGGAGCCTGCCCGGCAGCGGCCATGCCGAGCAGACCATGACCACCGAGATGGGCTGGCTG
GATACCCAGTTCACTCGTTCGCTGCTGTTCGCTGACCCGGTGGCCACCGCCTCGGCGCTGGTGGAGTGGC
TGCATACCTGGCTGTTCGTCAAGACGGGGATCGCCGGTTGGCTCGATCACAATGAGACCACCGGCGGCTG
GGTGGGGACACTGCACACGTACCTGGAAGCGGCTGTTTACGTCACCCTGATGACGCTGACGCGCTGTGTG
ATCCTGGTGCTGACGTCCCCCCTGTTTGTCATGGCCGCCCTGGTCGGCTTTATTGATGGGCTGGTAAGGC
GCGATCTCCGCCGCTTCGGCGCCGGCCGCGAATCGGCGTTCATCTACCACCACGCCAAACGCGCCGTGAC
GCCCATTTTCATCCTGGGCTGGCTGGTCTATCTCAGCGTACCGTTTTCCTTCCACCCCAATGTGTTCCTG
CTGCCGTGTGCCGTGCTGTTCGGCCTGATGATCAGCATCGCCACGGGTAGCTTCAAGAAGTATCTGTGA
 Primer design