SecReT4
Protein ID: 307546645
T4SS name [ID]Tfc [722]
Gene symbol-
Locus tagHELO_4055
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T4SS(s) in this replicon]
Location [Strand]3581290..3581667 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDE1VA51
KEGG IDhel:HELO_4055
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 8.5e-31, Aligned region: 2..120
Protein Sequence: 125 a.a.     [Download]
>gi|307546645|ref|YP_003899124.1| unnamed protein product [Halomonas elongata DSM 2581]
MATIEFIPRRLNETPIVFRGMTGREVAMVAFGGFVAFVPPGIVLAWWVGMVAVVPTVAFAGLGLSLLVGG
SIMRRLRRGRPPSLLYRRLQYRLAAMGWDGSGEHLITRTTAYRLRRGRRRNGGVS
 
Nucleotide Sequence: 378 bp     [Download]
>gi|307543589|ref|NC_014532.1|:3581290-3581667 Halomonas elongata DSM 2581 chromosome, complete genome
ATGGCCACGATCGAGTTCATCCCTCGACGCCTCAATGAGACACCGATCGTTTTCCGGGGCATGACCGGGC
GCGAGGTCGCCATGGTGGCCTTTGGCGGCTTCGTGGCCTTCGTGCCACCGGGCATCGTACTGGCCTGGTG
GGTCGGCATGGTAGCGGTGGTGCCGACCGTCGCCTTTGCCGGCCTGGGCCTCTCCCTGCTGGTCGGGGGC
AGCATCATGCGTCGACTGCGCCGTGGTCGCCCTCCCTCTCTTCTCTACCGTCGCTTGCAATACCGCCTGG
CTGCCATGGGCTGGGACGGTAGCGGCGAACACCTGATCACGCGCACGACAGCCTATCGGTTGCGCCGCGG
GCGCCGCCGTAACGGAGGAGTCTCATGA
 Primer design