SecReT4
Protein ID: 307546659
T4SS name [ID]Tfc [722]
Gene symbol-
Locus tagHELO_4069
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T4SS(s) in this replicon]
Location [Strand]3596097..3597515 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDE1VA65
KEGG IDhel:HELO_4069
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 472 a.a.     [Download]
>gi|307546659|ref|YP_003899138.1| unnamed protein product [Halomonas elongata DSM 2581]
MTHTMTRLTLGISLAAAVSTAQAQTASDALYYDIGGAAPISVSAGRGHSPSALSMGARWNLNATCGNFDM
GASVSNQLNGITNGFQNLMGDVVQNATGAVASLPAMVIQRANPQLYDLLQNGVLQGRLDYDKTKLSCQNM
AEQMTDFAMGEQSQQAAKAENWKATAKNTQDPVAAQEVVEEQGGNKGRTWVGGQKRGGENQEPIEVVEDT
AIAGYNQLHGRSDPTSTQSVSGGGQGWGSISTNDGDWPGGGSFSNAASGDCQGGMCTVWQDPQEAADWTK
SVIGETEIRTCDGCDKRQGQAGTGLMKALEEEQTTLAENLADLVSGNTDPTPSALNAVSAGPGLSVSRGV
IEAIRKDPDAELLTQRLAGEMALSRTLTKAMWARRTLLAGASEPGIANNEEGMTELERKLTHLDRDIDAL
KSELEVRTALANNAAQLALQRVAQRRANTSAPGVNLPESRRDNRGRPSEEAN
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|307543589|ref|NC_014532.1|:3596097-3597515 Halomonas elongata DSM 2581 chromosome, complete genome
ATGACACACACCATGACTCGCCTGACGCTGGGCATCAGCCTGGCGGCGGCGGTCAGCACCGCACAGGCGC
AAACCGCCTCGGATGCCCTGTATTACGATATCGGCGGCGCCGCCCCGATCAGCGTCTCCGCGGGGCGGGG
CCACTCGCCTTCGGCGCTCAGCATGGGCGCCAGGTGGAACCTCAACGCCACCTGCGGCAACTTCGACATG
GGCGCCTCCGTGTCGAACCAGCTCAACGGCATTACCAACGGCTTCCAGAACCTCATGGGTGATGTCGTCC
AGAACGCCACCGGGGCGGTGGCGTCGTTGCCCGCCATGGTGATCCAGCGAGCGAACCCCCAGCTCTATGA
CCTGCTGCAGAACGGTGTGCTGCAGGGGCGCCTGGACTATGACAAGACCAAGCTGTCGTGCCAGAACATG
GCCGAGCAGATGACCGACTTTGCCATGGGAGAGCAGTCCCAACAGGCTGCCAAGGCAGAGAATTGGAAGG
CTACCGCCAAGAACACCCAGGACCCTGTCGCTGCTCAGGAAGTGGTCGAGGAACAAGGCGGCAACAAGGG
CCGCACCTGGGTCGGCGGTCAAAAGCGCGGAGGGGAAAATCAAGAGCCGATCGAGGTCGTCGAGGATACA
GCGATCGCGGGTTACAACCAGCTGCACGGCCGTAGCGATCCCACCAGCACGCAGTCAGTCTCTGGCGGTG
GCCAAGGGTGGGGATCCATATCCACCAATGACGGTGACTGGCCGGGGGGCGGCAGTTTCAGTAATGCGGC
CTCGGGTGATTGCCAGGGGGGCATGTGCACTGTCTGGCAGGATCCCCAGGAGGCCGCTGACTGGACCAAA
TCCGTGATCGGTGAGACCGAGATCCGGACCTGCGATGGCTGTGATAAACGACAAGGCCAGGCCGGCACCG
GCCTGATGAAAGCCCTCGAGGAGGAACAGACCACCCTGGCCGAGAATCTCGCTGACCTGGTCAGTGGCAA
CACGGACCCCACGCCCAGCGCCCTGAATGCGGTGTCCGCTGGCCCGGGCCTGTCCGTCTCACGGGGCGTG
ATCGAAGCGATTCGCAAAGATCCCGATGCTGAACTGCTCACGCAGCGTCTGGCCGGTGAAATGGCGCTGT
CGCGCACCCTCACCAAAGCCATGTGGGCACGCCGCACGCTCCTCGCCGGCGCCAGTGAGCCAGGCATCGC
CAACAATGAAGAAGGCATGACCGAACTCGAGCGCAAGCTCACGCACCTCGATCGCGATATCGACGCGCTC
AAGAGCGAGCTGGAAGTCCGCACCGCGTTGGCCAACAACGCCGCCCAGCTGGCCCTCCAGCGTGTGGCGC
AGCGTCGGGCCAATACCAGTGCCCCAGGCGTCAACCTGCCCGAATCCCGTCGCGACAACCGCGGCCGTCC
GTCTGAGGAGGCCAATTAA
 Primer design