SecReT4
Protein ID: 308051520
T4SS name [ID]Tra_F [511]
Gene symbol-
Locus tagLLO_p0014
StrainLegionella longbeachae NSW150
Repliconplasmid pLLO [GenBank: NC_014544] [Browse all T4SS(s) in this replicon]
Location [Strand]12686..12976 [+]
Productputative conjugative transfer protein TraL
Component typeTraL_F
UniProt IDD3HTS2
KEGG IDllo:LLO_p0014
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.6e-07, Aligned region: 10..95
Protein Sequence: 96 a.a.     [Download]
>gi|308051520|ref|YP_003915094.1| putative conjugative transfer protein TraL [Legionella longbeachae NSW150]
MSHNYSTFMLSEEPRIAGIPLTTGLPVYLLTGIGLLIGLGPQLFVIGAVLSLIMHVQYGGLPLRALLGII
YWSLPHAMTTLIFRSFPNSAHRIYVG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|308051505|ref|NC_014544.1|:12686-12976 Legionella longbeachae NSW150 plasmid pLLO, complete sequence
ATGTCGCATAACTATTCCACATTTATGTTGTCAGAGGAGCCGCGCATTGCAGGGATTCCCCTGACCACTG
GATTACCCGTGTATTTACTCACGGGTATTGGATTACTGATTGGTTTAGGGCCACAGCTTTTTGTAATTGG
GGCTGTTTTAAGTTTAATCATGCATGTTCAGTATGGCGGGCTGCCCCTACGGGCTTTATTAGGAATAATT
TATTGGTCCCTACCGCATGCCATGACGACGCTTATTTTTAGGTCATTCCCTAATTCAGCGCATCGAATCT
ATGTAGGATGA
 Primer design