SecReT4
Protein ID: 308051531
T4SS name [ID]Tra_F [511]
Gene symbol-
Locus tagLLO_p0025
StrainLegionella longbeachae NSW150
Repliconplasmid pLLO [GenBank: NC_014544] [Browse all T4SS(s) in this replicon]
Location [Strand]22969..23757 [+]
Productputative conjugative transfer protein TraF
Component typeTraF_F
UniProt IDD3HTT3
KEGG IDllo:LLO_p0025
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.7e-53, Aligned region: 28..246
Protein Sequence: 262 a.a.     [Download]
>gi|308051531|ref|YP_003915105.1| putative conjugative transfer protein TraF [Legionella longbeachae NSW150]
MSRLLMLLVWGLFVTSLHADIVQEHAKGFHWYSVEEQSKPIKKIVQPRPATVAKSPYERLMDKRKETLNK
LAEALIAPSFNATHEYMKAQMDYSKNNQQFVRYWQQVLLFHPELDSTLNFPTDNSAIAVRNDAQKVLINK
VIHESSARYGFILFYRGTSSISQKMVMHLLPFIKEYGFSMISVNTDGQLIDGLPNPKSIPLETVQKQVAL
EAKYMPALYFVDLKSNKMSPVSYGFLSLEELKQRIFDVMTQFKRFSYEGVNE
 
Nucleotide Sequence: 789 bp     [Download]
>gi|308051505|ref|NC_014544.1|:22969-23757 Legionella longbeachae NSW150 plasmid pLLO, complete sequence
ATGAGCCGCCTGTTAATGCTGTTGGTATGGGGATTGTTCGTGACATCGCTTCATGCAGATATTGTTCAGG
AGCATGCAAAAGGATTTCATTGGTATAGTGTTGAGGAGCAGTCCAAACCGATTAAAAAAATAGTACAGCC
ACGACCTGCAACGGTTGCGAAATCTCCTTATGAACGTTTAATGGATAAGCGTAAGGAAACTCTGAATAAA
TTGGCAGAGGCTTTGATTGCGCCATCCTTTAATGCAACGCACGAGTATATGAAAGCGCAGATGGATTATT
CAAAAAATAATCAGCAATTTGTGCGCTATTGGCAACAAGTCTTATTGTTCCATCCTGAGTTGGATAGCAC
GCTGAATTTTCCAACCGACAACTCAGCGATTGCGGTACGTAATGATGCACAAAAAGTATTAATCAATAAA
GTGATTCATGAAAGCAGTGCACGCTATGGCTTTATCTTATTTTATCGTGGCACGAGCTCCATTTCACAAA
AAATGGTCATGCATTTATTGCCCTTCATTAAAGAATATGGTTTTTCCATGATTTCAGTCAATACGGATGG
CCAACTCATTGATGGGCTTCCTAATCCTAAATCAATCCCTCTGGAAACTGTTCAAAAACAAGTAGCACTC
GAGGCGAAGTACATGCCAGCGCTGTATTTCGTGGACTTAAAGAGCAATAAGATGTCGCCTGTGTCTTATG
GGTTTTTATCTTTAGAAGAGTTGAAACAGCGCATTTTTGATGTGATGACTCAGTTTAAACGATTCAGTTA
TGAAGGAGTGAATGAATGA
 Primer design