SecReT4
Protein ID: 308182676
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02565
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]502151..503596 [+]
Productcag pathogenicity island protein (cag3)
Component typeCagdelta
UniProt IDE1Q610
KEGG IDhpc:HPPC_02565
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 481 a.a.     [Download]
>gi|308182676|ref|YP_003926803.1| cag pathogenicity island protein (cag3) [Helicobacter pylori PeCan4]
MFRKLATAVSLIGLLTSNTLYAKEISEADKVIKATKETKETKKEAKRLKKEAKQHQQIPDHKKPQYASVD
DTKTQALFDIYDTLNVNDKSFGDWFGNSALKDKTYLYAMDLLDYNNYLSIENPIIKTRAMGTYADLIIIT
GSLEQVNGYYNILKALNKRNAKFVLKINDKIPYAQATFLRVPKRSDPNAHTLDKGASIDESKLFEQQKKM
YFNYANDVICRPDDEVCSPLRDEMVAMPTNDSVTQKPNIIAPYSLYRLKETNNANEAQPSPYATQTAPEN
SKEKLIEELIANSQLVANEEEREKKLLAEKEKQEAELAKYKLKDLENQKKLKALEAELKKKNAKKPRVVE
VPIPHQTSDSDKTMRVIKEKENYNGLLVDKETTIKRSYEGTLISENSYSKKTPLNPNDLRRLEEEIKSYY
IKSNGLCYSNGINLYVKIKNDPYKEGMLCGYESVQNLLSPLKDKLKYDKQKLQKALLKDSK
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|308182188|ref|NC_014555.1|:502151-503596 Helicobacter pylori PeCan4 chromosome, complete genome
ATGTTTAGAAAACTAGCAACCGCTGTATCGCTCATAGGCTTACTAACCTCTAACACTCTTTATGCTAAAG
AAATAAGTGAAGCCGATAAGGTCATTAAGGCCACTAAAGAAACTAAAGAGACCAAGAAAGAAGCTAAACG
ACTCAAAAAAGAAGCTAAACAGCACCAACAGATCCCTGATCATAAGAAACCTCAATATGCCTCTGTTGAT
GACACAAAAACTCAAGCGCTGTTTGATATATACGACACCTTGAATGTGAATGACAAAAGCTTTGGGGATT
GGTTTGGTAATAGCGCTTTGAAAGACAAAACCTATCTCTACGCTATGGATCTGTTGGATTATAACAACTA
CTTATCCATAGAAAATCCCATCATCAAAACAAGAGCAATGGGAACTTATGCGGATCTCATCATCATCACA
GGCTCGTTAGAACAAGTCAATGGGTATTACAACATTTTAAAAGCACTCAACAAGCGCAACGCTAAATTTG
TCTTAAAGATTAACGATAAGATACCTTACGCTCAAGCGACTTTTCTAAGAGTGCCAAAAAGAAGCGATCC
TAATGCCCACACGCTTGATAAGGGAGCGTCAATTGATGAAAGCAAGCTTTTTGAACAACAAAAGAAAATG
TATTTCAACTACGCTAATGATGTGATCTGCAGACCCGATGATGAAGTGTGTTCGCCCCTAAGAGATGAGA
TGGTAGCTATGCCCACTAACGATAGCGTTACCCAAAAACCCAATATCATTGCTCCCTATAGTTTATACAG
GCTAAAAGAGACAAATAACGCCAATGAAGCCCAACCATCACCTTATGCTACCCAAACCGCTCCTGAAAAC
AGCAAAGAGAAGCTCATAGAAGAGCTAATCGCTAACTCCCAACTCGTAGCCAATGAAGAAGAGAGGGAAA
AGAAACTCTTAGCAGAAAAAGAAAAACAAGAGGCTGAATTGGCTAAATACAAGCTCAAAGACTTAGAAAA
TCAAAAGAAACTAAAAGCTTTAGAAGCAGAGTTGAAAAAGAAAAACGCTAAGAAACCTAGAGTAGTGGAA
GTGCCTATTCCTCATCAAACAAGTGATTCTGATAAAACAATGAGAGTTATCAAAGAAAAAGAAAACTATA
ATGGATTATTAGTGGATAAAGAGACCACGATCAAAAGAAGCTATGAGGGGACTTTGATCAGTGAAAATTC
TTACAGCAAAAAAACACCTCTCAACCCTAATGACTTGAGAAGATTAGAAGAAGAAATTAAGAGCTACTAT
ATCAAGTCTAATGGCTTGTGTTACTCTAATGGCATTAACCTCTATGTAAAAATCAAAAATGATCCCTACA
AAGAGGGAATGCTGTGTGGTTATGAGAGCGTTCAAAATCTGCTCTCACCACTAAAAGACAAGCTCAAATA
CGACAAGCAGAAGTTACAAAAAGCGTTACTGAAAGATTCAAAGTAA
 Primer design