SecReT4
Protein ID: 308182677
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02570
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]503606..504115 [+]
Productcag pathogenicity island protein (cag4)
Component typeCaggamma
UniProt IDE1Q611
KEGG IDhpc:HPPC_02570
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.5e-07, Aligned region: 36..150
Protein Sequence: 169 a.a.     [Download]
>gi|308182677|ref|YP_003926804.1| cag pathogenicity island protein (cag4) [Helicobacter pylori PeCan4]
MFEKWIGLTLLLSSLGYPCQKITISFKQYENLIHIHQKGCDNEVVCRTLISIALLESSLGLNNKREKSLK
DTSYSMFHITLNTAKKFYPTYSKTLLKTKLLNDVDFAIQLAKQILKENFDYYKQKHPNKSVYQLVEMAIG
AYNGGMKHNPNGTYVKKFRCIYSQVRYNE
 
Nucleotide Sequence: 510 bp     [Download]
>gi|308182188|ref|NC_014555.1|:503606-504115 Helicobacter pylori PeCan4 chromosome, complete genome
TTGTTTGAGAAATGGATTGGTCTGACCTTACTCCTTAGTTCCTTAGGCTATCCATGCCAAAAAATAACCA
TTAGTTTCAAGCAATACGAAAATCTTATCCATATCCATCAAAAAGGCTGCGACAATGAAGTGGTGTGCAG
AACGCTCATCTCTATCGCTTTACTAGAAAGCTCTCTAGGGTTGAACAACAAGCGAGAAAAATCCCTTAAA
GACACCTCTTATTCCATGTTCCATATCACCCTAAACACCGCTAAAAAGTTCTACCCTACCTATTCTAAAA
CGCTCCTCAAAACCAAATTGTTAAACGATGTGGATTTTGCGATCCAATTAGCCAAACAAATTTTAAAAGA
AAATTTTGATTATTACAAACAAAAACACCCCAACAAAAGCGTGTATCAATTAGTGGAAATGGCAATAGGC
GCTTATAATGGGGGAATGAAACACAACCCTAATGGCACTTATGTGAAGAAGTTTCGCTGCATTTATTCTC
AAGTGCGTTACAACGAGTAG
 Primer design