SecReT4
Protein ID: 308182678
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02575
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]504255..506501 [-]
Productcag pathogenicity island protein Beta
Component typeCagbeta
UniProt IDE1Q612
KEGG IDhpc:HPPC_02575
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.5e-180, Aligned region: 177..713
TraG-D_C [PF12696], Evalue: 4.2e-24, Aligned region: 545..668
TrwB_AAD_bind [PF10412], Evalue: 1.5e-10, Aligned region: 509..672
Protein Sequence: 748 a.a.     [Download]
>gi|308182678|ref|YP_003926805.1| cag pathogenicity island protein Beta [Helicobacter pylori PeCan4]
MEDFLYNTLYFIEDYKLVVIFSFIGLIALFFLYKFIKAQKKAFKDKANQPQKKKNFKEIIIEGLKERVKT
FGFWLQAILLLSYSFITSGLFFLILLGNFYDDNRSPESDDDLFDIWIYAIQDFPAYYFKALCFSSLKIYG
FNISLVVYSSILCSYIFITFFVWFLKYLTRTRDIGANKKVDDLFGSASWETEEKMIKAKLITPNNKKRAF
DKREVIVGRRGLGDFIAYAGQAFIGLIAPTRSGKGVGFIMPNMINYPQNIVVFDPKADTMETCGKIREKR
FNQKVFIYEPFSLKTHRFNPFAYVDFGNDVVLTEDILSQIDTRLKGHGMVASGGDFSTQIFGLAKLVFPE
RPNEKDPFFSNQARNLFVINCNIYRDLMWTKKGLEFVKRKKIIMPETPTMFFIGSMASGINLIDEDTNME
KVVSLMEFFGGEEDKSGDNLRALSPATRNMWNNFKTMGGARETYSSVQGVYTSAFAPYNNAMIRNFTSAN
DFDFRRLRIDEVSIGVIANPKESTIVGPILELFFNVMIYSNLILPIHDPQCKRSCLMLMDEFTLCGYLET
FVKAVGIMAEYNMRPAFVFQSKAQLENDPPLGYGKNGAKTILDNLSLNMYYGINNDNYYEHFEKLSKVLG
KYTRQDVSRSIDDNTGKTNTSISNKERFLMTPDELMTMGDELIILENTLKPIKCHKALYYDDPFFTDELI
KVSPSLSKKYKLGKVPNQATFYDDLQAAKTRGELSYDKSLVPVGSSEL
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c506501-504255 Helicobacter pylori PeCan4 chromosome, complete genome
ATGGAAGACTTTTTGTATAACACCTTATATTTCATAGAGGATTATAAGTTGGTTGTTATTTTTAGTTTCA
TAGGGTTAATAGCGTTATTTTTTCTTTACAAATTCATAAAAGCTCAAAAAAAGGCTTTTAAAGATAAAGC
TAACCAACCTCAAAAGAAAAAAAACTTTAAAGAAATCATTATAGAGGGGCTGAAAGAAAGAGTTAAAACC
TTTGGCTTTTGGTTGCAAGCTATACTATTACTATCCTATTCTTTTATCACATCAGGGTTATTTTTCTTGA
TTCTCTTAGGTAATTTTTATGACGATAATAGATCGCCTGAGAGTGATGACGATCTTTTTGATATATGGAT
CTATGCGATACAAGATTTTCCTGCATACTATTTTAAGGCACTTTGTTTTAGTTCACTCAAAATTTATGGG
TTCAATATATCCTTAGTCGTATATAGTTCTATTTTATGCTCTTATATCTTCATTACCTTTTTTGTGTGGT
TCTTAAAATACTTAACTCGGACTAGAGACATAGGAGCGAATAAAAAAGTTGATGATCTCTTTGGGAGTGC
GAGTTGGGAAACTGAAGAGAAAATGATCAAAGCCAAGCTCATCACGCCCAACAACAAAAAACGCGCCTTT
GACAAACGAGAGGTTATTGTAGGCAGGCGTGGCTTGGGGGATTTTATCGCTTACGCAGGGCAGGCGTTTA
TTGGACTCATTGCCCCTACTAGGAGCGGTAAAGGTGTGGGTTTCATCATGCCCAATATGATCAATTATCC
TCAAAATATCGTTGTGTTTGACCCTAAAGCTGACACTATGGAAACTTGCGGAAAAATCAGAGAAAAACGA
TTCAACCAAAAAGTGTTCATCTATGAACCTTTCTCCTTAAAAACACACCGATTTAATCCTTTCGCTTATG
TGGATTTTGGTAATGATGTGGTTTTGACTGAAGACATACTCTCTCAAATTGACACACGCCTAAAAGGGCA
TGGCATGGTGGCTAGTGGAGGGGATTTTTCCACTCAAATCTTTGGATTGGCAAAGCTCGTGTTCCCTGAA
AGACCTAATGAAAAAGATCCTTTTTTTAGCAATCAAGCACGAAATCTTTTTGTCATTAATTGCAATATTT
ATAGGGATCTCATGTGGACTAAAAAGGGGCTTGAGTTTGTCAAAAGAAAAAAAATCATCATGCCTGAAAC
CCCTACGATGTTTTTCATAGGTTCTATGGCAAGCGGTATCAACTTGATTGATGAAGACACAAACATGGAA
AAAGTCGTGTCTCTGATGGAATTTTTTGGAGGTGAAGAAGATAAGAGTGGCGATAATCTAAGAGCGCTTA
GTCCTGCTACTAGAAACATGTGGAACAACTTCAAAACAATGGGTGGCGCTAGAGAAACTTACAGCTCTGT
TCAAGGGGTCTATACCTCAGCGTTTGCGCCTTACAATAATGCTATGATTAGGAATTTCACGAGCGCTAAT
GATTTTGATTTCAGGCGTTTGAGGATTGATGAAGTGAGTATTGGCGTGATCGCTAACCCTAAAGAAAGCA
CTATTGTTGGGCCGATATTAGAGCTGTTTTTCAATGTGATGATTTATAGCAACCTTATTCTGCCAATCCA
TGATCCGCAATGCAAAAGAAGTTGTTTGATGCTTATGGACGAGTTCACGCTCTGTGGCTATTTAGAAACC
TTTGTGAAAGCGGTAGGGATTATGGCAGAATACAACATGCGCCCTGCCTTTGTGTTTCAAAGTAAGGCAC
AACTAGAGAATGACCCCCCACTTGGTTATGGTAAAAATGGCGCTAAGACTATTTTAGACAACCTTTCTTT
AAATATGTATTATGGGATTAACAACGATAACTACTATGAACATTTTGAAAAACTTTCTAAGGTGTTGGGG
AAATACACTAGACAAGACGTGAGCCGAAGCATTGATGACAATACCGGTAAGACCAATACTTCTATCAGCA
ACAAAGAGCGGTTTTTGATGACCCCTGATGAATTGATGACCATGGGCGATGAGCTTATCATTTTAGAAAA
CACGCTCAAACCCATCAAATGCCACAAGGCACTCTACTATGATGATCCGTTCTTCACCGATGAACTCATT
AAGGTGAGTCCAAGCTTAAGCAAGAAATACAAATTGGGGAAAGTGCCTAATCAAGCAACTTTCTATGATG
ATTTGCAAGCCGCTAAAACTAGAGGCGAATTGAGCTATGACAAGTCTTTAGTGCCTGTGGGTTCAAGCGA
ATTGTGA
 Primer design