SecReT4
Protein ID: 308182679
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02580
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]506510..507502 [-]
ProductvirB11-like cag pathogenicity islandencoded protein / ATPase protein
Component typeCagalpha
UniProt IDE1Q613
KEGG IDhpc:HPPC_02580
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.9e-56, Aligned region: 36..318
DEAD [PF00270], Evalue: 7.7e-05, Aligned region: 161..224
Protein Sequence: 330 a.a.     [Download]
>gi|308182679|ref|YP_003926806.1| virB11-like cag pathogenicity islandencoded protein / ATPase protein [Helicobacter pylori PeCan4]
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLKNNGEWQPFDV
RDRKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSPVTVNDETISISIRIPSKTTY
PHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIMEFIPKEERIISIEDTEEI
VFKHHKNYTQLFFGGNITSADCLKSCLRMRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEA
FIRLANMSSSNSAARNIKFESLIEGFKDLIDIVVHINHHKQCDEFYIKHR
 
Nucleotide Sequence: 993 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c507502-506510 Helicobacter pylori PeCan4 chromosome, complete genome
ATGACTGAAGACAGATTGAGTGCAGAAGATAAAAAATTTCTAGAAGTAGAAAGAGCTTTAAAAGAAGCGG
CATTAAATCCTCTAAGGCATGCTACTGAAGAACTTTTTGGTGATTTTTTAAAAATGGAAAATATCACTGA
GATTTGTTACAATGGGAACAAGGTTGTATGGGTTTTAAAAAATAATGGCGAATGGCAACCATTTGATGTG
AGAGACAGGAAAGCCTTTAGTTTGTCTCGTTTAATGCATTTTGCTCGGTGTTGTGCAAGTTTTAAGAAAA
AAACAATAGACAACTATGAAAATCCTATTTTGAGCAGCAATTTAGCGAATGGTGAAAGGGTGCAGATTGT
CCTTTCCCCTGTTACAGTTAATGATGAAACCATTTCCATATCCATAAGGATACCTAGCAAAACAACCTAT
CCTCATAGCTTCTTTGAAGAGCAGGGTTTTTATAATCTACTAGATAACAAAGAACAAGCGATCAGTGCGA
TTAAAGATGGTATTGCTATTGGTAAAAATGTGATTGTTTGTGGTGGCACAGGAAGCGGTAAAACGACTTA
TATCAAAAGCATCATGGAGTTTATCCCCAAAGAAGAAAGGATCATATCCATTGAAGACACCGAAGAGATT
GTATTCAAACACCACAAGAACTACACACAGCTTTTTTTTGGTGGGAATATCACCTCTGCTGATTGCTTAA
AGTCATGTCTGAGAATGCGGCCTGATAGAATCATTTTAGGGGAACTCAGAAGCAGTGAGGCATACGATTT
TTATAATGTGCTTTGTAGCGGTCATAAAGGCACGCTAACCACTCTGCATGCAGGGAGCAGTGAAGAAGCG
TTTATCCGTTTAGCCAACATGAGTTCATCTAATAGCGCAGCAAGGAATATCAAGTTTGAAAGCCTCATTG
AAGGCTTTAAAGATTTGATTGATATAGTTGTTCATATCAACCACCACAAACAGTGTGATGAATTTTATAT
CAAACATAGGTAG
 Primer design