SecReT4
Protein ID: 308182680
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02585
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]507507..508106 [-]
Productcag pathogenicity island protein Z
Component typeCagZ
UniProt IDE1Q614
KEGG IDhpc:HPPC_02585
PDB IDNA
Domain hit(s) vs Pfam CagZ [PF09053], Evalue: 7e-138, Aligned region: 1..199
Protein Sequence: 199 a.a.     [Download]
>gi|308182680|ref|YP_003926807.1| cag pathogenicity island protein Z [Helicobacter pylori PeCan4]
MELGFNEAERQKILDSNKSLMGNADEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDAYY
NYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFI
DGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
 
Nucleotide Sequence: 600 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c508106-507507 Helicobacter pylori PeCan4 chromosome, complete genome
ATGGAACTCGGTTTTAATGAAGCAGAAAGACAAAAGATCTTAGATAGCAACAAATCTCTTATGGGAAATG
CAGATGAAGTAAGGGATAAGTTTATTCAAAATTACGCCTCTTCTTTAAAAGATAGCAACGATCCGCAAGA
TTTTTTGAGAAGAGTTCAAGAGTTAAGAATCAATATGCAAAAGAATTTTATTAGTTTTGATGCTTATTAC
AACTATTTGAACAATCTTGTGTTAGCCAGTTACAATCGTTGCAAACAAGAAAAAACTTTTGCAGAAAGCA
CGATCAAAAATGAACTAACGCTTGGAGAGTTTGTTGCAGAAATTTCTGACAACTTCAATAATTTCATGTG
TGATGAAGTGGCAAGAATTTCAGACCTAGTGGCTTCTTATCTGCCAAGAGAGTATTTACCGCCATTCATA
GATGGCAATATGATGGGCGTGGCGTTTCAGATTCTAGGGATAGATGATTTTGGGAGAAAGCTCAATGAGA
TTGTCCAAGATATAGGGACTAAATATATCATTTTGAGCAAAAATAAGACTTATCTCACTTCTTTAGAAAG
AGCTAAATTGATAACCCAATTAAAATTAAATTTGGAATAA
 Primer design