SecReT4
Protein ID: 308182681
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02595
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]510659..510754 [-]
Producthypothetical protein
Component typeCagY
UniProt IDE1Q615
KEGG IDhpc:HPPC_02595
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 1.6e-14, Aligned region: 2..27
Protein Sequence: 31 a.a.     [Download]
>gi|308182681|ref|YP_003926808.1| hypothetical protein HPPC_02595 [Helicobacter pylori PeCan4]
MDCVSQAKTEAEKKECEKLLTPEAKKKVRRS
 
Nucleotide Sequence: 96 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c510754-510659 Helicobacter pylori PeCan4 chromosome, complete genome
TTGGATTGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAG
CGAAAAAAAAAGTTAGAAGAAGCTAA
 Primer design