SecReT4
Protein ID: 308182682
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02605
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]513792..515357 [-]
Productcag pathogenicity island protein X
Component typeCagX
UniProt IDE1Q616
KEGG IDhpc:HPPC_02605
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.3e-38, Aligned region: 54..170
CagX [PF03524], Evalue: 2.3e-38, Aligned region: 256..489
Protein Sequence: 521 a.a.     [Download]
>gi|308182682|ref|YP_003926809.1| cag pathogenicity island protein X [Helicobacter pylori PeCan4]
MEQAFFKKIVNCFCLGYLFLSSVIEAAPDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLEK
DETISYITTGFNKGWNIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKEL
EEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSELIKQQRENEL
DQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKDKISIKTDKSQKSPEDNSIELSPSDSAWRTNL
VVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQRELIKQENLNTTAYI
NRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIFD
DGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDKALVTVINKG
YGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1566 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c515357-513792 Helicobacter pylori PeCan4 chromosome, complete genome
ATGGAGCAGGCATTTTTTAAAAAAATTGTTAACTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGTAA
TAGAAGCAGCACCTGACATTAAAAATTTTAATCGTGGCAGGGTGAAAGTGGTGAATAAGAAGATTGCTTA
TTTGGGAGATGAAAAACCCATCACGATTTGGACTTCATTAGACAATGTTACTGTGATCCAACTTGAAAAA
GATGAAACTATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAATATTGTGCCTAATTCTAATCATA
TATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCCCTAAT
GACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCGCCTGACCCTAAAGAATTA
GAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCGCAAAAAGCGCAAAAAGATA
AAAGAGAAAAAAGAAAGGAGGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTATGAG
TAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTGATCAAGCAACAGAGAGAAAATGAATTA
GACCAAATGGAACGACTAGAAGACATGCAAGAGCAGGCTCAAGCTAACGCGCTCAAACAAATTGAAGAAC
TCAACAAGAAACAAGCTGAAGAGACAATCAAGCAAAGAGCCAAAGATAAAATCAGTATTAAGACAGATAA
ATCTCAAAAAAGCCCCGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGAACCAATCTT
GTTGTGCGGACTAATAAAGCCTTGTATCAATTCATTTTGAGGATAGCTCAAAAAGACAATTTTGCTTCGG
CGTATCTAACAGTCAAATTAGAATACCCACAAAGACACGAAGTCTCTAGCGTTATTGAAGAGGAATTAAA
AAAGAGAGAAGAAGCAAAGAGGCAGAGAGAATTGATCAAGCAAGAAAATCTCAACACCACAGCCTACATC
AATAGAGTAATGATGGCGAGCAATGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAACAAAAAA
TTATACTAGATCAAGCAAAGGCACTAGAGACCCAATATGTGCATAATGCGTTAAAAAGAAACCCTGTGCC
TAGAAACTACAATTACTACCAAGCGCCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTTGAT
GATGGCACATTCACTTATTTTGGTTTCAAAAACATCACTCTCCAACCTGCTATTTTTGTGGTTCAACCTG
ATGGGAAATTAAGCATGACTGATGCTGCTATTGATCCTAACATGACCAATTCAGGATTGAGATGGTATAG
AGTTAATGAAATTGCAGAAAAGTTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTAATAAATAAAGGC
TATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGTGTGATTAAAA
AGCTCCCTCTTGTCAGAGATAAATAA
 Primer design