SecReT4
Protein ID: 308182683
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02610
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]515410..517017 [-]
Productcag pathogenicity island protein W
Component typeCagW
UniProt IDE1Q617
KEGG IDhpc:HPPC_02610
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 535 a.a.     [Download]
>gi|308182683|ref|YP_003926810.1| cag pathogenicity island protein W [Helicobacter pylori PeCan4]
MFNIKRTFLITIISFFLIVPNWLKAIDLPIVSNLKIYQTVYCMLIPSYVLTNKSFADILTGYTSIGASGS
GKSSGQGVIEALSAPLATSLATSNLVKYLNTLGPLWGSAWASVATAIQGFALTPSSGCNFGWNALINKNI
DVSTDSMLDNLSNKIQNFTKGGVEDNVKGNVLLQIINSITAQASTNITANGLIWLIGKEFTANKLQNNTT
AMLAFAALESIVKGADTAVLPAYGVVNLPDIIIGQGSYLDFVSYLIYIVFGIFVFISFMKLRDISNGIQI
NIGFEYMRFVGGTLFKMAMVSFIAYAGFGYLYKISYSIYFGLAGAFGLNQVLFWALDLVLNYTVNSILPA
VRAVFSNVGNNAPSLLQGLQVAGISLFAIFMQVTIIMRISTVVVKPLIAGAFSGIVFPIAVCLIVLDWFK
DSMKNILIWFINNLFILVLAIPILLFGVLALLAFNLTITPSVAIQNINQGGLGIDSTIASLITLFILKGF
IETIIESINAIVNTIFSSVSMDGSRMDRERDALMVGRVGGSMFKG
 
Nucleotide Sequence: 1608 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c517017-515410 Helicobacter pylori PeCan4 chromosome, complete genome
ATGTTTAATATCAAAAGGACTTTCTTAATAACGATCATAAGTTTTTTTCTCATTGTTCCTAATTGGTTGA
AAGCTATTGATTTGCCCATTGTTTCAAATCTCAAAATTTACCAAACAGTTTATTGCATGCTGATACCGAG
TTATGTTTTAACCAACAAAAGTTTTGCAGATATTTTGACAGGTTATACATCTATTGGTGCATCAGGGAGT
GGAAAGAGTTCAGGGCAGGGTGTGATCGAAGCGCTTAGTGCACCATTAGCTACAAGTTTAGCCACTAGCA
ATCTAGTGAAATATTTGAATACTTTAGGTCCTTTATGGGGATCGGCGTGGGCGAGTGTTGCTACAGCTAT
ACAAGGTTTTGCTCTAACCCCATCAAGTGGTTGCAATTTTGGTTGGAACGCATTGATAAATAAAAACATA
GATGTATCCACAGATAGCATGCTAGACAATTTGAGCAACAAGATTCAGAATTTTACCAAAGGCGGTGTTG
AGGACAATGTGAAAGGCAATGTTCTTTTACAAATAATTAACTCAATAACCGCTCAAGCTTCTACGAATAT
TACAGCTAATGGTTTAATTTGGCTGATTGGCAAAGAATTCACTGCAAATAAACTGCAAAACAACACTACA
GCCATGCTTGCTTTTGCCGCACTAGAATCTATTGTCAAAGGAGCGGACACTGCTGTTCTTCCTGCATATG
GTGTAGTCAATCTGCCTGATATTATCATAGGGCAAGGGTCATATCTTGATTTTGTTTCTTACCTAATTTA
TATTGTTTTTGGGATTTTTGTTTTTATTTCTTTTATGAAATTGAGAGATATTTCAAATGGCATTCAGATT
AACATAGGTTTTGAATACATGCGATTTGTTGGGGGGACATTATTCAAAATGGCGATGGTCTCTTTTATCG
CCTACGCAGGTTTTGGTTATCTTTATAAAATCTCTTATTCCATTTATTTTGGTTTAGCAGGTGCTTTTGG
GCTGAATCAAGTTCTTTTTTGGGCTTTAGATTTAGTGCTGAATTACACTGTTAATTCAATTTTACCTGCG
GTAAGAGCTGTTTTTTCTAATGTTGGCAACAACGCTCCTAGTTTGCTCCAAGGCTTGCAAGTTGCAGGTA
TTTCTTTATTCGCTATTTTTATGCAAGTAACTATCATTATGAGAATAAGCACTGTTGTTGTGAAACCTTT
GATAGCGGGGGCTTTTAGCGGTATTGTGTTCCCTATTGCGGTATGTTTGATCGTGCTAGATTGGTTCAAA
GATTCTATGAAAAACATATTGATATGGTTTATTAATAATTTGTTTATCTTGGTTCTAGCTATTCCTATTT
TGCTCTTTGGTGTTTTGGCATTATTGGCATTCAATTTGACCATAACGCCCTCTGTTGCTATACAAAACAT
CAATCAAGGGGGACTAGGTATCGATTCGACTATTGCGAGTTTGATCACTTTATTTATTTTAAAAGGTTTC
ATAGAGACGATTATTGAGAGTATCAATGCGATCGTTAATACCATTTTCAGCTCTGTCTCTATGGATGGCA
GCAGAATGGATAGAGAAAGAGATGCCTTAATGGTAGGAAGAGTTGGTGGATCTATGTTTAAAGGATAA
 Primer design