SecReT4
Protein ID: 308182684
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02615
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]517022..517780 [-]
Productcag island protein
Component typeCagV
UniProt IDE1Q618
KEGG IDhpc:HPPC_02615
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-21, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|308182684|ref|YP_003926811.1| cag island protein [Helicobacter pylori PeCan4]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMVLNIAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITPDTMENYEYITKKQVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALKK
 
Nucleotide Sequence: 759 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c517780-517022 Helicobacter pylori PeCan4 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAGGAAGTCTTGATTGATGAAAATTTAGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAAGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGTGCTCAATAT
CGCTGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACAGATATATTTGTTTATGGCATTGAT
CGATATACAGGAGAATTTAAAATTGTCAAACGCTCCGATGCTAGGCAAATTGTCAATTCTGAAGCTGTTG
TGGATAGTGCAACTTCAAAATTTGTCTCATTGCTGTTTGGTTATAGTAAAAATTCTTTGAGGGATCGCAA
GGATCAACTAATGCAGTATTGCGATGTGAGTTTTCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTCGTAGATAAAGTCCGAGCAGAAGCTATCATTAGCTCTAACATACAAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACGTTTTTCATTACCATCAAAATCACACCTGATACAATGGAAAATTATGA
ATATATTACTAAAAAACAAGTAACGATTTATTATGATTTTGCTAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGCTTCAAAGTGTTTGACATTCAAATCACAGATTTACAAAACGAACAGACGGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAAGAAATAA
 Primer design