SecReT4
Protein ID: 308182685
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02620
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]518055..518702 [+]
Productcag pathogenicity island protein (cagU, cag11)
Component typeCagU
UniProt IDE1Q619
KEGG IDhpc:HPPC_02620
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 215 a.a.     [Download]
>gi|308182685|ref|YP_003926812.1| cag pathogenicity island protein (cagU, cag11) [Helicobacter pylori PeCan4]
MNDATERHGSNSLNAPSPSNSQSNDLLNLLDSLYPKGSLGEQRFHEALKNQEELKNILIEIEKLPQEKRY
ELLMQIGQAKQRIMEAYAHSFLGYIGGIEHLLGLCMGGIFVLFAIYFVFLRTSKNTDLVESLKTKLKLQY
FYYAFGVGAVLFFGLETIRSVYELYILGIGSTNDKVLFVLKNICFIGMGYLIYKVIKVIGIKNFINGLFT
SKKQE
 
Nucleotide Sequence: 648 bp     [Download]
>gi|308182188|ref|NC_014555.1|:518055-518702 Helicobacter pylori PeCan4 chromosome, complete genome
ATGAACGATGCAACAGAGCGCCATGGATCCAATTCGCTAAACGCCCCATCACCTAGCAACTCACAGAGCA
ATGATCTTTTAAATTTGCTAGACTCGTTATATCCCAAAGGGAGTTTAGGGGAGCAAAGATTTCACGAAGC
CCTAAAGAATCAAGAAGAGTTGAAAAATATCCTAATAGAAATAGAAAAGCTACCGCAAGAAAAAAGGTAT
GAACTTCTGATGCAGATAGGACAAGCCAAACAGAGAATAATGGAAGCATACGCTCATTCATTCTTGGGAT
ATATAGGTGGAATAGAGCATCTGTTAGGATTATGTATGGGTGGGATATTTGTTTTGTTTGCAATCTATTT
TGTATTTTTAAGAACTAGCAAAAACACGGATTTGGTGGAAAGTCTAAAAACAAAACTAAAACTTCAGTAT
TTTTACTATGCCTTTGGTGTGGGTGCGGTTTTGTTTTTTGGATTAGAAACAATTAGATCTGTTTATGAAC
TATATATATTAGGAATTGGTAGCACTAACGATAAGGTGCTTTTTGTTTTGAAAAACATTTGCTTCATAGG
TATGGGCTATTTGATCTATAAAGTTATTAAGGTTATTGGTATAAAAAATTTTATCAATGGTCTTTTCACT
TCAAAGAAACAAGAATAA
 Primer design