SecReT4
Protein ID: 308182686
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02625
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]518718..519560 [+]
ProductCAG pathogenicity island protein 12
Component typeCagT
UniProt IDE1Q620
KEGG IDhpc:HPPC_02625
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 7e-36, Aligned region: 13..123
Protein Sequence: 280 a.a.     [Download]
>gi|308182686|ref|YP_003926813.1| CAG pathogenicity island protein 12 [Helicobacter pylori PeCan4]
MKLRASVLIGATILCLILSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNNKEQPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQAKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|308182188|ref|NC_014555.1|:518718-519560 Helicobacter pylori PeCan4 chromosome, complete genome
ATGAAACTGAGAGCAAGTGTTTTAATCGGTGCGACAATTCTGTGCTTAATTTTAAGCGCGTGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAACTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGACAATAAACAAGTTGTATTAACTTTCAAACTTGTCCATCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATACTTCAATACAAGAATTACTTCCAAGCTAATGGAGCGAGATCCGA
TATTGATTTTTACTTGCAGCCTACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTATAATGAT
AATCCTAACAATAAAGAACAACCACAGACCTTTGATGTGTTGCAAGGGAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAGAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAAACTCTCTTGCAAGACAAGGAACAAGAATAT
ACCACTAGGAAAAATAACCAACGAGAAATTTTAGAAACCTTGAGTAATCGTGCAGGTTATCAAATGAGGC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAAGCCAAAGAAGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTACGCAATCAGATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design