SecReT4
Protein ID: 308182692
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02655
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]523305..524435 [+]
Productcag pathogenicity island protein (cagM, cag16)
Component typeCagM
UniProt IDE1Q626
KEGG IDhpc:HPPC_02655
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|308182692|ref|YP_003926819.1| cag pathogenicity island protein (cagM, cag16) [Helicobacter pylori PeCan4]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LVDHRAKVLSDLENKYKKEKEALEKETRGKILAAKSKAYGDLEQALKDNSLYKKLLPNPYAYVLNQETFT
KEDKERLSYYYPQVKNSNIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNISN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNALIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVLSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|308182188|ref|NC_014555.1|:523305-524435 Helicobacter pylori PeCan4 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCGTTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAGGTGGCTGCAAAAGAAGACGCTCTTAAGGCCCG
CAAAAAGCTCTTAAATAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTGTGGATCATAGAGCTAAAGTTCTTTCAGATTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAGATCCTTGCTGCTAAGTCAAAGGCTTATGGGGATCTAGAGCAAGCCTTAAA
AGATAACTCTCTCTATAAAAAACTTCTTCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACC
AAAGAAGATAAGGAGCGTTTGAGTTATTACTACCCACAAGTCAAAAACAGCAACATTTTCAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACATTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAACAAGTTTGACTCCA
AAGCAAAAGATATCGCTCAAAAAGCTACTAACGCGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATCAATGAGAAATACTTAAGGGGCTATGAGGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAATTGAACACTCTGACTAAAAACTTTACCAATCAAAAATTGAGTTTCGCTCAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGCGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGCTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design