SecReT4
Protein ID: 308182693
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02660
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]524450..525361 [+]
Productcag pathogenicity island protein (cagN, cag17)
Component typeCagN
UniProt IDE1Q627
KEGG IDhpc:HPPC_02660
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 303 a.a.     [Download]
>gi|308182693|ref|YP_003926820.1| cag pathogenicity island protein (cagN, cag17) [Helicobacter pylori PeCan4]
MKSIFKKLGSVALYFLVIYGGLNAINTALLPSEYKKLVALGFKKLYQRHDDKEVTEEEKKFATNALREKL
RNDRARAEQIQKNIEAFEKKNNSSIQKKATKHKGLQELNETNANPLNGNPNSNSSTETKSNKDDNFDEMI
NKVNEAFVKPATPLVPNEWRTPEIETIINECIISSNDYDGLRKCLIKGIKDQKILAPLLEKIQEIETENN
KFSRQHLSGLKLALNNSNNRTFLIASCAICEKRKKEMEQENNYQDTTNTSEFGATDTKENEAKDATFSNN
RSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 912 bp     [Download]
>gi|308182188|ref|NC_014555.1|:524450-525361 Helicobacter pylori PeCan4 chromosome, complete genome
TTGAAAAGTATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTTTTTAGTTATTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTACCGAGTGAATACAAAAAATTAGTGGCTTTAGGCTTTAAAAAACTCTATCA
AAGACATGACGACAAAGAAGTTACAGAAGAGGAAAAAAAATTCGCCACTAACGCTTTGAGAGAAAAATTA
CGAAATGATAGGGCGAGAGCGGAGCAAATTCAAAAAAATATTGAAGCGTTTGAAAAAAAGAACAACTCTT
CTATTCAAAAAAAAGCGACTAAGCACAAAGGATTACAAGAATTAAACGAAACTAACGCTAACCCTTTGAA
TGGCAATCCTAATAGTAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAACTTTGATGAGATGATC
AATAAGGTGAATGAAGCTTTTGTGAAACCTGCTACTCCGCTTGTGCCTAATGAGTGGAGAACGCCTGAAA
TTGAAACCATTATCAATGAGTGCATTATTTCAAGCAACGATTACGATGGGTTAAGGAAGTGTTTGATCAA
AGGCATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATTCAAGAAATAGAGACAGAAAATAAC
AAGTTTTCTAGACAACACTTGAGTGGTTTAAAGCTCGCTCTTAATAACAGCAACAATAGAACCTTTCTTA
TAGCTTCGTGTGCTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAACTACCAAGATACTAC
AAATACAAGCGAGTTTGGAGCTACTGATACAAAAGAAAATGAAGCAAAAGATGCAACATTCTCAAACAAT
CGCTCTAAATCCGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATGGAAAAAAAT
AG
 Primer design