SecReT4
Protein ID: 308182694
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02665
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]525442..526155 [-]
Productcag pathogenicity island protein L
Component typeCagL
UniProt IDE1Q628
KEGG IDhpc:HPPC_02665
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|308182694|ref|YP_003926821.1| cag pathogenicity island protein L [Helicobacter pylori PeCan4]
MKTLVKNTLFSFLLLSVLMAEDITSGLKQLDSTYQETNQQVLKNLDEIFSTTSPSANNEIGQEDALNIKK
AAMALRGDLALLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQNTAEQQCGISDKVLVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTASLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEE
LDALERSLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c526155-525442 Helicobacter pylori PeCan4 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCCTATTTTCTTTTTTGCTATTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTGGATAGCACCTACCAAGAGACCAACCAGCAAGTGCTCAAAAACCTAGATGA
GATTTTTTCAACCACTAGCCCTAGCGCTAATAATGAAATAGGTCAAGAAGATGCTCTAAACATCAAAAAA
GCGGCCATGGCTTTGAGGGGAGATTTAGCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTCAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAATACTGCTGAGCAACAATGCGGAATATCCGATAAAGTTTTAGTTCTTTATTGTGAA
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCCCTAAAGGCGTATC
AGAGCAACATTGGAGGTACAGCTTCTTTAATTACTGCTTCACAGACGCTTGTAGAAAGCCTAAAGAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGGAG
TTGGACGCATTAGAAAGATCCCTAGAACAAAGCAAGCGACAATACCTACAAGAAAGGCAATCAAGTAAGA
TCATTGTCAAATGA
 Primer design