SecReT4
Protein ID: 308182695
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02670
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]526152..527291 [-]
Productcag pathogenicity island protein I
Component typeCagI
UniProt IDE1Q629
KEGG IDhpc:HPPC_02670
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 379 a.a.     [Download]
>gi|308182695|ref|YP_003926822.1| cag pathogenicity island protein I [Helicobacter pylori PeCan4]
MKYFLSIFSFLTFLFLNGGEAVITLEPALKAIQADAQAKQKTAQAELKAIEAQSNAKEKAIQAQIEGELR
TQLATMSAMLKGANGVINGVNGMTGGFFAGSDILLGVMEGYSSALSALGGNVKMIVEKQKINTQTEIQNM
QIALQKNNEIIKLKMNQQNALLEALKNSFEPSVTLKTQMEMLSQALGSSSDNAQYIAYNTIGIKAFEETL
KGFETWLKTAMQKATLIDYNSLTGQALFQSAIYAPALSFFSSMGAPFGIIETFTLAPTKCPYLDGLKISA
CLMEQVIQNYRMIVALIQNKLSDADFQNIAYLNGINGEIKTLKGSVDLNALIEVAILNAENHLNYIENLE
KKADLWEEQLKLERETTARNIASSKVIVK
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c527291-526152 Helicobacter pylori PeCan4 chromosome, complete genome
GTGAAATATTTTTTAAGCATATTTTCTTTCTTAACTTTTTTGTTTCTGAATGGTGGAGAGGCAGTAATAA
CGCTTGAACCTGCCTTAAAAGCCATTCAAGCGGATGCACAAGCCAAACAAAAAACCGCTCAAGCCGAATT
AAAAGCCATAGAGGCTCAATCTAATGCCAAAGAAAAAGCCATTCAAGCGCAAATAGAGGGAGAATTGAGG
ACTCAGCTTGCAACTATGAGCGCTATGTTAAAAGGGGCTAATGGCGTTATTAATGGTGTCAATGGCATGA
CAGGGGGGTTTTTTGCAGGTTCAGACATCTTGCTTGGCGTCATGGAAGGGTATTCAAGCGCGCTTAGCGC
ATTGGGGGGGAATGTCAAAATGATCGTGGAAAAACAAAAAATTAACACCCAAACAGAAATCCAAAACATG
CAAATTGCGCTCCAAAAAAATAACGAAATAATCAAGCTCAAAATGAACCAGCAAAACGCTCTCTTAGAAG
CGTTAAAAAACAGCTTTGAACCGAGCGTTACTCTAAAAACACAAATGGAAATGCTTTCTCAAGCTCTAGG
AAGTTCTTCTGACAACGCTCAATACATCGCTTACAATACGATTGGTATCAAGGCGTTTGAAGAAACCTTA
AAAGGTTTTGAAACATGGTTGAAAACAGCTATGCAAAAAGCGACCCTTATTGATTATAATTCCCTAACAG
GTCAGGCTTTGTTTCAAAGCGCCATCTACGCGCCTGCTCTTAGTTTTTTTTCAAGCATGGGCGCACCATT
TGGAATCATTGAAACATTCACTCTAGCACCCACAAAATGCCCCTATCTTGATGGGCTAAAAATTTCAGCA
TGCCTTATGGAACAGGTTATTCAGAATTACAGAATGATTGTAGCCCTTATTCAAAATAAACTGAGTGATG
CAGATTTTCAAAATATCGCTTATTTGAATGGGATCAATGGAGAAATCAAAACCTTAAAAGGATCAGTAGA
TTTGAACGCACTCATAGAAGTTGCTATCTTAAACGCAGAAAATCATTTAAACTATATAGAGAATCTTGAA
AAAAAAGCCGACCTTTGGGAAGAACAACTGAAATTAGAAAGAGAAACGACAGCAAGAAACATTGCTAGCT
CTAAAGTTATTGTCAAATGA
 Primer design