SecReT4
Protein ID: 308182696
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02675
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]527302..528246 [-]
Productcag pathogenicity island protein H
Component typeCagH
UniProt IDE1Q630
KEGG IDhpc:HPPC_02675
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 314 a.a.     [Download]
>gi|308182696|ref|YP_003926823.1| cag pathogenicity island protein H [Helicobacter pylori PeCan4]
MTAIMTQYNQSIAEAVSMPMKAANQQYNQLYQGFNDQSMAVGNNILNISKLTGEFNAQGNTQGAQIGAVN
SQIASILASNTTPKNPSAIEAYATNQIAVPSVPTTVEMMSAILGNITSAAPKYALALQEQLRSQASNSSM
NDTADSLDSCTALGALASSSKVFFSCMQISMTPMSVSMPTVYAKYQALAANALTSGTNPMTTPACPIGDK
VLVVYCYAEKVAEILREYYIEFVKNNTNLLQNASQMILNQSGLATSTYDTQAISNISSLYNYNIVANKSF
LKSHLTYLDYIKDKLKGQKDSYLTERVQTKIIVK
 
Nucleotide Sequence: 945 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c528246-527302 Helicobacter pylori PeCan4 chromosome, complete genome
ATGACCGCTATCATGACCCAATACAATCAGAGCATCGCTGAAGCCGTAAGCATGCCTATGAAAGCCGCTA
ACCAACAATACAACCAATTGTATCAAGGTTTTAACGATCAAAGCATGGCTGTGGGGAACAATATCTTAAA
TATCAGCAAATTAACAGGGGAATTTAACGCGCAAGGCAACACGCAAGGCGCGCAAATTGGTGCTGTTAAT
AGTCAGATTGCAAGCATTTTAGCGAGTAACACTACCCCTAAAAATCCCAGTGCTATTGAAGCTTATGCGA
CGAATCAAATCGCTGTTCCTAGTGTGCCAACAACGGTTGAAATGATGAGCGCTATCTTAGGCAATATTAC
AAGCGCAGCACCGAAATACGCCCTAGCCCTACAAGAGCAACTGCGTTCTCAAGCAAGCAACAGCTCAATG
AATGATACAGCCGATTCCCTTGATAGCTGTACCGCTTTAGGTGCGCTTGCTAGCTCATCAAAAGTGTTTT
TTAGTTGCATGCAAATTTCTATGACTCCTATGAGTGTCTCTATGCCCACTGTTTATGCTAAATACCAAGC
GTTAGCCGCTAATGCCCTAACTTCAGGCACTAATCCTATGACCACTCCTGCATGCCCTATTGGGGACAAA
GTTCTTGTCGTTTATTGCTATGCTGAAAAAGTAGCAGAAATTTTGAGAGAATACTATATAGAATTTGTGA
AAAACAATACCAATTTGTTGCAAAACGCTTCTCAAATGATACTTAATCAATCAGGATTAGCTACTAGCAC
CTATGACACTCAAGCGATTTCTAACATAAGCTCGCTATATAACTACAATATAGTAGCGAATAAATCTTTT
TTGAAATCGCATCTGACTTATCTTGATTACATCAAAGACAAACTTAAGGGGCAAAAAGATAGCTACCTAA
CAGAAAGGGTGCAAACTAAAATAATCGTGAAGTGA
 Primer design