SecReT4
Protein ID: 308182698
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02685
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]528431..528859 [-]
Productcag pathogenicity island protein G
Component typeCagG
UniProt IDE1Q632
KEGG IDhpc:HPPC_02685
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|308182698|ref|YP_003926825.1| cag pathogenicity island protein G [Helicobacter pylori PeCan4]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAVL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYSDSSFLPPIL
GY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c528859-528431 Helicobacter pylori PeCan4 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGCATGTTTAACGCTC
CACTTAACGCTGACCAAAACACTGATATAAAAGATATTAGTCCTGAAGATATGGCACTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAGCTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCGTACTC
AATGACTATAATGATAAAAATGTTAATATCAAGTTTGATGACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
TCCAAACAATCCTTTCATGTATGGTTATGCACCAACATACTCAGATTCATCGTTTTTACCACCGATCTTA
GGGTATTAA
 Primer design