SecReT4
Protein ID: 308182699
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02690
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]528914..529720 [-]
Productcag island protein
Component typeCagF
UniProt IDE1Q633
KEGG IDhpc:HPPC_02690
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 268 a.a.     [Download]
>gi|308182699|ref|YP_003926826.1| cag island protein [Helicobacter pylori PeCan4]
MKQNLREQKLLKILENDVLTILDSFSNYLFELREELDFIEEEMEGEITEQNLTTLYDFSNFLEDHVNVFY
ENVLNIDDVKTEHLYSGLIDSLNANLHFVKSFLSNQDLDFRFFKEINEGQDPQKTLSRLIPLQSGKNDAS
SFKANNSFVSLVYVYAYFMLETIRQSYRILRLLEKPINNNISEDMQSDIENFFVQANFLEYYVQNKIYPT
NHAYDFTHLIMDSIIPNWIQTDMSVEAKKKELFEKYFQNIDEVTNKMLDQENQNKNSD
 
Nucleotide Sequence: 807 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c529720-528914 Helicobacter pylori PeCan4 chromosome, complete genome
ATGAAACAAAATTTGCGTGAACAAAAATTATTGAAAATTTTAGAAAATGATGTCTTGACGATTTTGGATA
GTTTTTCTAATTATCTTTTTGAACTGAGAGAAGAATTGGACTTCATAGAAGAAGAAATGGAAGGCGAAAT
CACTGAACAAAACCTTACCACTCTTTATGATTTTTCTAATTTCTTAGAAGACCATGTCAATGTATTTTAT
GAGAATGTTTTGAATATAGATGATGTCAAAACAGAACACCTTTATTCAGGTCTCATAGACAGTCTTAACG
CTAATCTTCACTTTGTCAAGTCATTTCTCAGTAATCAGGATTTAGACTTCCGCTTTTTTAAAGAAATAAA
CGAAGGGCAAGATCCCCAAAAAACATTATCAAGATTAATTCCTCTTCAAAGTGGGAAAAATGATGCAAGC
TCGTTTAAAGCCAATAATTCTTTTGTTTCATTAGTTTATGTTTATGCTTACTTCATGCTAGAAACTATCA
GGCAGTCGTATAGGATTCTCAGATTACTAGAAAAACCTATCAATAACAACATAAGCGAGGACATGCAGAG
CGATATAGAGAATTTTTTTGTTCAAGCAAATTTTTTAGAATACTATGTTCAGAACAAAATATACCCAACC
AATCATGCCTATGACTTCACGCATTTGATCATGGACTCCATTATTCCTAATTGGATTCAAACTGATATGA
GCGTTGAAGCTAAAAAGAAAGAGCTTTTTGAAAAATATTTTCAAAACATTGATGAAGTAACAAACAAAAT
GCTCGATCAAGAAAATCAAAACAAAAACAGCGATTGA
 Primer design