SecReT4
Protein ID: 308182700
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02695
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]529722..532673 [-]
Productcag pathogenicity island protein E
Component typeCagE
UniProt IDE1Q634
KEGG IDhpc:HPPC_02695
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.3e-57, Aligned region: 326..531
AAA_10 [PF12846], Evalue: 5.6e-49, Aligned region: 591..906
AAA_23 [PF13476], Evalue: 1.9e-05, Aligned region: 584..982
Protein Sequence: 983 a.a.     [Download]
>gi|308182700|ref|YP_003926827.1| cag pathogenicity island protein E [Helicobacter pylori PeCan4]
MFVASKQADEQKKLIIEQEVQKRQFQKIEELKADMQKGVNPFFKVLFDGGNRLFGFPETFIYSSIFILFV
TVVLSVILFQAYEPVLIVAIVIVLVALGFKKDYRLYQRMERAMKFKKPFLFKGVKNKAFMSIFSMKPSKE
MANDIHLNPNREDRLVSAANSYLANNYECFLDDGVILTNNYSLLGTIKLGGIDFLTTSKKDLIELHASIY
SVFRNFVTPEFKFYFHTIKKKIVIDETNRDYGLAFSNDFMRAYNEKQKRESFYDISFFLTIEQDLLDTLN
EPVMNKKHFADNNFEEFQRIIRAKLENFKDRIELIEELLSKYHPTRLKEYIKDGVVYSKQCEFYNFLVGM
NEAPFICNRKDLYLKEKMHGGVKEVYFANKHGKILNDDLSEKYFSAIEISEYAPKSQSDLFDKINALDSE
FIFMHAYSPKNSQVLKDKLAFTSRRIIISGGSKEQGMTLGCLSELVGNGDITLGSYGNSLVLFADSFEKM
KQSVKECVSSLNAKGFLANAATFSMENYFFAKHCSFITLPFIFDVTSNNFADFIAMRAMSFDGNQENNAW
GNSVMTLKSEINSPFYLNFHMPTDFGSASAGHTLILGSTGSGKTVFMSMTLNAMGQFAYNFPANVSKDKQ
KLTMVYMDKDYGAYGNIVAMGGEYVKIELGTDTGLNPFAWAACVQKTNATMEQKQTAISVVKELVKNLAT
KSDEKDENGNSISFSLADSNTLAAAVTNLITGDMNLDYPITQLINAFGKDHNDPNGLVARLAPFCKSTNG
EFQWLFDNKATDRLDFSKTIIGVDGSSFLDNNDVSPFICFYLFARIQEAMDGRRFVLDIDEAWKYLGDPK
VAYFVRDMLKTARKRNAIVRLATQSITDLLACPIADTIREQCPTKIFLRNDGGNLSDYQRLANVTEKEFE
IITKGLDRKILYKQDGSPSVIASFNLRGIPKEYLKILSTDTVFVKEIDKIIQNHSIIDKYQALRQMYQQI
EEY
 
Nucleotide Sequence: 2952 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c532673-529722 Helicobacter pylori PeCan4 chromosome, complete genome
GTGTTTGTGGCAAGCAAACAAGCTGACGAACAAAAAAAGCTAATCATAGAGCAAGAGGTTCAAAAGCGGC
AGTTTCAAAAAATAGAAGAGCTTAAAGCAGACATGCAAAAAGGTGTCAATCCCTTTTTTAAAGTCTTGTT
TGATGGGGGGAATAGATTGTTTGGTTTCCCTGAAACTTTTATTTATTCCTCCATATTTATATTATTTGTA
ACAGTTGTATTATCTGTTATTCTTTTTCAAGCTTATGAACCTGTTTTGATTGTAGCGATTGTTATTGTGC
TTGTAGCTCTTGGATTCAAGAAAGATTATAGGCTTTATCAAAGAATGGAGCGAGCGATGAAATTTAAAAA
ACCTTTTTTGTTTAAGGGCGTGAAAAACAAAGCATTCATGAGCATTTTTTCCATGAAGCCTAGTAAAGAA
ATGGCTAATGACATCCACTTAAATCCAAACAGAGAAGACAGACTTGTGAGTGCTGCAAACTCCTATTTGG
CGAATAACTATGAATGTTTTTTAGATGATGGGGTGATCCTTACTAACAACTATTCTCTTTTAGGCACAAT
CAAATTGGGGGGCATTGATTTTTTAACCACTTCCAAAAAAGATCTCATAGAGTTACACGCTTCTATTTAT
AGCGTTTTTAGGAATTTTGTTACCCCTGAATTCAAATTTTATTTTCACACTATTAAAAAGAAAATCGTTA
TTGATGAAACCAATAGGGATTATGGTCTTGCTTTTTCTAATGATTTCATGCGAGCCTATAATGAGAAGCA
AAAGAGAGAAAGTTTTTATGATATTAGTTTTTTTCTCACCATAGAGCAAGATTTATTAGACACTCTCAAT
GAACCCGTTATGAATAAAAAGCATTTTGCAGACAATAATTTTGAAGAGTTTCAAAGGATTATTAGAGCCA
AGCTTGAAAACTTCAAGGATAGGATAGAGCTTATAGAAGAGCTATTGAGTAAATACCACCCCACTAGATT
AAAAGAATATATTAAAGATGGGGTTGTTTATTCCAAACAATGCGAGTTTTACAATTTTCTTGTGGGAATG
AATGAAGCCCCTTTTATTTGCAACAGAAAAGACTTGTATCTCAAGGAAAAAATGCATGGTGGGGTGAAAG
AAGTTTATTTTGCCAATAAGCATGGAAAAATCTTAAATGATGATTTGAGTGAAAAATATTTTAGCGCTAT
TGAGATTAGTGAATACGCCCCTAAATCACAGAGCGATTTGTTTGACAAGATCAACGCTCTAGACAGCGAA
TTTATCTTTATGCATGCTTATTCGCCTAAAAACTCACAGGTTTTAAAGGACAAACTAGCTTTCACCTCTA
GAAGGATTATTATTAGTGGGGGCTCTAAAGAGCAGGGCATGACTTTAGGTTGCTTGAGCGAATTAGTGGG
TAATGGTGATATTACGCTAGGCAGTTATGGTAATTCTTTAGTGCTGTTTGCTGATAGCTTTGAAAAAATG
AAACAAAGCGTCAAGGAATGCGTCTCTAGTCTTAACGCTAAAGGTTTTTTAGCCAACGCAGCGACTTTCT
CTATGGAAAATTACTTTTTTGCCAAACATTGCTCTTTTATTACGCTTCCTTTTATTTTTGATGTAACTTC
TAATAATTTTGCTGATTTTATCGCTATGAGAGCGATGAGTTTTGATGGCAATCAAGAGAATAACGCTTGG
GGTAATAGCGTCATGACGCTAAAAAGCGAGATCAATTCGCCTTTTTATCTGAACTTCCACATGCCCACTG
ATTTTGGTTCAGCTTCAGCAGGACACACTTTGATACTTGGCTCAACCGGTTCAGGTAAGACAGTGTTTAT
GTCAATGACCTTGAACGCTATGGGGCAATTTGCCTATAATTTTCCTGCTAATGTCAGCAAAGACAAGCAA
AAGCTCACTATGGTCTATATGGATAAAGATTATGGCGCTTATGGGAATATTGTCGCAATGGGTGGGGAGT
ATGTCAAGATTGAGCTAGGGACAGATACAGGATTAAATCCTTTTGCTTGGGCGGCTTGTGTGCAAAAAAC
AAATGCAACAATGGAGCAAAAACAAACAGCTATTTCTGTTGTCAAAGAGCTTGTGAAAAACTTAGCAACC
AAAAGCGATGAAAAAGATGAAAATGGCAACAGCATCTCTTTTAGCCTAGCAGATTCTAATACGCTTGCAG
CGGCAGTAACCAACCTTATCACAGGAGATATGAACCTAGATTATCCTATCACTCAACTTATTAATGCTTT
CGGAAAAGACCACAATGATCCTAATGGGCTTGTCGCGCGATTAGCACCTTTTTGCAAATCAACCAATGGT
GAATTTCAATGGCTTTTTGACAATAAAGCAACAGATCGCTTAGATTTTTCAAAAACGATTATTGGCGTTG
ATGGGTCAAGTTTCTTAGACAATAATGATGTTTCGCCCTTTATTTGTTTTTACCTTTTCGCTCGTATCCA
AGAGGCAATGGATGGGCGTAGATTTGTCTTGGATATTGATGAAGCTTGGAAATATTTAGGCGATCCAAAG
GTCGCTTATTTTGTAAGAGACATGCTAAAAACTGCAAGGAAAAGAAACGCTATTGTCAGGCTTGCGACTC
AAAGCATCACTGATCTTTTGGCTTGCCCTATTGCTGATACGATTAGAGAACAATGCCCTACAAAGATTTT
TTTAAGAAACGATGGGGGCAATCTTTCTGATTACCAAAGATTGGCTAATGTTACAGAAAAAGAATTTGAA
ATCATCACTAAGGGACTAGATAGGAAAATTCTCTACAAACAAGATGGAAGCCCTAGCGTTATCGCTAGTT
TTAATTTGAGAGGCATTCCTAAAGAATATTTGAAAATTTTATCCACAGATACTGTATTTGTCAAAGAAAT
TGACAAGATTATCCAAAACCATAGTATCATAGATAAATATCAGGCCTTGAGGCAAATGTATCAACAAATA
GAGGAGTATTAA
 Primer design