SecReT4
Protein ID: 308182701
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02700
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]532682..533305 [-]
Productcag pathogenicity island protein D
Component typeCagD
UniProt IDE1Q635
KEGG IDhpc:HPPC_02700
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 207 a.a.     [Download]
>gi|308182701|ref|YP_003926828.1| cag pathogenicity island protein D [Helicobacter pylori PeCan4]
MINNNSNKKLRGFFLKVLLSLVVFSSYGSANDDNQAKKEALEKEKNTPNGLVYTNLDFDSFKATIKNLKD
KKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKEMGLNVELQINPEVKDFFTFK
SISTTNKQRCFLSLRGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTVESLKKIFYTITCEAVYL
 
Nucleotide Sequence: 624 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c533305-532682 Helicobacter pylori PeCan4 chromosome, complete genome
TTGATCAACAATAATAGTAATAAAAAACTGAGAGGCTTTTTTTTGAAAGTTCTCTTAAGTCTCGTTGTTT
TCAGTTCGTATGGGTCAGCGAATGATGATAATCAAGCCAAAAAAGAAGCGCTAGAAAAAGAAAAAAACAC
TCCCAATGGGCTTGTTTATACGAATTTAGATTTTGATAGTTTTAAAGCGACTATCAAAAATTTGAAAGAC
AAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAGTTTTTGACTTCGTGATTGTCA
ATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCCATTATTGAAAAAATCTTTGATGAAAA
GGGTAAAGAAATGGGATTGAATGTGGAATTACAGATCAATCCTGAAGTGAAAGACTTTTTTACTTTCAAA
AGCATCAGCACGACCAACAAACAACGCTGCTTTCTGTCATTGCGCGGAGAAACAAGGGAAATTTTATGCG
ATGATAAGCTATATAATGTTTTATTGGCCGTATTCAATTCTTATGACCCTAACGATCTTTTGAAACACAT
TAGCACCGTAGAGTCTCTCAAAAAAATCTTTTATACGATTACATGTGAAGCGGTGTATCTATAA
 Primer design