SecReT4
Protein ID: 308182702
T4SS name [ID]Cag [33]
Gene symbol-
Locus tagHPPC_02705
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]533307..533654 [-]
Productcag pathogenicity island protein C
Component typeCagC
UniProt IDE1Q636
KEGG IDhpc:HPPC_02705
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|308182702|ref|YP_003926829.1| cag pathogenicity island protein C [Helicobacter pylori PeCan4]
MKFFTRITDSYKKVVVTLGLVMTTNPLMAVTSPATGVTETKTLVIQIISVLAIVGGCALGVKGIADIWKI
SDDIKRGQATVFAYAQPIAMLAVAGGIIFLSTKFGFNIDEGGGAS
 
Nucleotide Sequence: 348 bp     [Download]
>gi|308182188|ref|NC_014555.1|:c533654-533307 Helicobacter pylori PeCan4 chromosome, complete genome
ATGAAATTTTTTACAAGAATCACTGACAGCTACAAGAAAGTTGTAGTAACTTTAGGGCTAGTGATGACAA
CCAATCCTTTAATGGCGGTCACCAGTCCTGCAACAGGCGTTACTGAGACTAAAACTTTGGTTATTCAGAT
CATTTCTGTTCTAGCGATCGTAGGTGGTTGCGCTTTAGGGGTCAAAGGCATAGCAGATATTTGGAAAATC
TCTGATGACATCAAAAGAGGTCAGGCGACTGTTTTTGCTTACGCGCAACCCATAGCTATGTTAGCGGTGG
CAGGCGGTATTATCTTTTTGAGCACTAAGTTTGGCTTCAATATTGACGAGGGTGGAGGAGCTAGCTAA
 Primer design