SecReT4
Protein ID: 308183668
T4SS name [ID]VirB [610]
Gene symbol-
Locus tagHPPC_07705
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]1544901..1546070 [+]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDE1Q5C2
KEGG IDhpc:HPPC_07705
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.1e-24, Aligned region: 164..348
Protein Sequence: 389 a.a.     [Download]
>gi|308183668|ref|YP_003927795.1| VirB8 type IV secretion protein [Helicobacter pylori PeCan4]
MSKRSEVLEQFHGGLKNLELQTKRRMDLWGDLKENEEQTLLLEEIENELKQLENKEDLKADNNTGLKEEN
QDTKENYPNDLFSLPLPIQTTTNEIKEFVEEPVIETEEKETPQNESIQEEKERIFKNFFSRIGFNKSIAP
TMLFEEVRDASVIYHLEKKLGDYIFYVACFFFGTTVLLVILLIVLLPLKQKEPYLVQFSNNKENFALVQK
ADSTITANKALIRSLVGAYVLNRESITHIEQHEKIRQNTIKEQSSNEVWYEFEKLIAYHDSIYTNPLLIR
KVKIANIYLDKDLAYIDIEVGLYHSGELESLKRYKVVMSFEFKKQEINFDSMSLNPTGFIVTGYDVTEIA
ILKDLDEKNKVKDDGVKSRIIHTEKKDPHMSQYKDIKEQ
 
Nucleotide Sequence: 1170 bp     [Download]
>gi|308182188|ref|NC_014555.1|:1544901-1546070 Helicobacter pylori PeCan4 chromosome, complete genome
ATGTCAAAAAGAAGCGAAGTTTTAGAACAATTTCATGGCGGTTTAAAAAATTTAGAATTACAAACTAAAA
GACGCATGGATTTGTGGGGCGATCTAAAAGAGAATGAAGAACAAACTTTGCTTTTAGAAGAAATTGAAAA
TGAATTAAAACAATTAGAAAATAAAGAAGATCTTAAAGCAGACAATAACACAGGGCTTAAAGAAGAAAAT
CAAGACACTAAAGAAAACTATCCTAACGACTTGTTTTCTTTGCCATTACCCATTCAAACCACCACCAATG
AAATTAAAGAGTTTGTAGAAGAGCCTGTGATAGAAACAGAAGAAAAAGAAACACCCCAAAACGAGTCAAT
CCAAGAAGAAAAAGAAAGAATTTTTAAAAACTTTTTCTCCAGAATAGGCTTTAATAAAAGTATTGCTCCC
ACAATGCTCTTTGAAGAAGTGAGAGATGCAAGCGTTATCTATCATTTAGAGAAAAAATTAGGCGATTATA
TATTTTATGTAGCGTGTTTCTTCTTTGGTACAACAGTACTGCTTGTTATCTTACTGATCGTTCTGTTGCC
GTTAAAACAAAAAGAGCCGTATTTAGTGCAATTTTCTAACAATAAAGAAAATTTTGCTTTAGTTCAAAAG
GCAGATAGCACCATTACAGCCAATAAAGCTCTTATTCGTTCATTAGTGGGAGCGTATGTGCTAAATAGGG
AAAGCATTACTCATATTGAACAACATGAAAAAATACGTCAAAACACCATTAAAGAGCAAAGTTCCAATGA
GGTATGGTATGAATTTGAAAAACTCATCGCTTATCATGACAGCATTTACACGAATCCTTTACTTATAAGA
AAGGTAAAGATTGCAAATATCTATTTAGATAAAGATTTAGCCTATATTGACATTGAAGTGGGCTTGTATC
ATAGCGGAGAATTAGAGAGCTTAAAACGCTATAAAGTGGTGATGAGTTTTGAATTTAAAAAACAAGAAAT
CAATTTTGACTCCATGTCTTTAAACCCTACAGGCTTTATTGTTACAGGTTATGACGTAACTGAAATTGCG
ATTTTAAAAGACTTGGATGAGAAAAATAAAGTCAAAGATGATGGTGTGAAATCTAGGATTATCCATACCG
AGAAAAAAGACCCTCACATGAGCCAATATAAAGATATTAAGGAGCAATAA
 Primer design