SecReT4
Protein ID: 308183674
T4SS name [ID]VirB [610]
Gene symbol-
Locus tagHPPC_07735
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]1549767..1550708 [+]
ProductVirB11 type IV secretion ATPase
Component typeVirB11
UniProt IDE1Q5C8
KEGG IDhpc:HPPC_07735
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.5e-49, Aligned region: 14..290
Protein Sequence: 313 a.a.     [Download]
>gi|308183674|ref|YP_003927801.1| VirB11 type IV secretion ATPase [Helicobacter pylori PeCan4]
MISNLLKSYLDDFMPILSQPNLNEVVFNKEKEYFLHRPKEKVRCFNEKFTNDYLLVFCEQLAIFRNQKFT
LKTPKLNTSLPYTQIRINALHPSIIASSNISINIRVPSNFKFEINAFKLSEKCLAKNITYDFLLSLVSSG
KNILISGGTASGKTSFVNSLIENIPKNERVVTIEDSPELKISNEDQVNILVDKSGSGFFTYEDGLNAAMR
MSPDRLLLGEIDTHNTALFLRLANTGHSGMISTLHANSVVDAFIAICQNINLNKGGKPTPKETLLDYFCT
GMDYVIQIKKKGSDRIIDDVLNVKSEFKKELVL
 
Nucleotide Sequence: 942 bp     [Download]
>gi|308182188|ref|NC_014555.1|:1549767-1550708 Helicobacter pylori PeCan4 chromosome, complete genome
ATGATTTCTAATCTTTTAAAAAGTTACCTTGATGACTTTATGCCTATTTTAAGCCAACCTAATTTAAATG
AAGTGGTTTTTAATAAAGAAAAAGAGTATTTTTTGCACCGCCCAAAAGAAAAAGTGAGGTGTTTTAATGA
AAAATTTACTAACGATTATTTGTTGGTTTTCTGTGAGCAATTAGCCATTTTTAGAAACCAAAAATTCACT
CTAAAAACGCCTAAGTTAAACACTTCTTTGCCTTACACGCAAATTAGAATTAACGCATTACACCCTAGCA
TTATTGCTAGTTCTAATATCTCTATCAATATTAGAGTGCCTAGCAATTTCAAGTTTGAAATTAACGCCTT
TAAATTAAGTGAGAAATGTCTGGCTAAAAACATTACCTATGATTTTTTACTTAGCTTAGTAAGCTCAGGT
AAAAATATCTTAATTAGTGGTGGCACAGCTAGCGGTAAAACTAGCTTTGTTAATTCCTTGATTGAAAATA
TTCCCAAAAACGAAAGGGTGGTTACTATTGAAGATAGTCCTGAATTAAAAATCAGTAATGAAGATCAAGT
CAATATTTTAGTGGATAAAAGCGGGAGCGGGTTTTTCACTTATGAAGATGGCTTAAATGCGGCTATGAGA
ATGTCTCCTGATAGATTATTATTAGGCGAAATTGACACGCATAACACTGCGTTATTTTTGCGTTTAGCAA
ATACCGGGCATAGCGGAATGATAAGCACCTTACACGCCAATAGTGTGGTAGATGCTTTTATAGCTATTTG
TCAGAATATCAACTTGAATAAAGGCGGTAAGCCTACCCCTAAAGAAACGCTTTTAGATTATTTTTGCACT
GGTATGGACTATGTTATCCAAATCAAAAAAAAAGGTAGCGATAGGATAATTGATGATGTTTTAAATGTTA
AAAGCGAATTTAAAAAGGAGTTGGTGTTATGA
 Primer design