SecReT4
Protein ID: 308183678
T4SS name [ID]VirB [610]
Gene symbol-
Locus tagHPPC_07755
StrainHelicobacter pylori PeCan4
Repliconchromosome [GenBank: NC_014555] [Browse all T4SS(s) in this replicon]
Location [Strand]1552006..1553754 [+]
Productconjugal transfer protein (traG)
Component typeVirD4
UniProt IDE1Q5D2
KEGG IDhpc:HPPC_07755
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.1e-68, Aligned region: 83..564
TrwB_AAD_bind [PF10412], Evalue: 6.6e-30, Aligned region: 323..542
TraG-D_C [PF12696], Evalue: 2.2e-24, Aligned region: 411..531
AAA_10 [PF12846], Evalue: 2.1e-10, Aligned region: 82..188
AAA_10 [PF12846], Evalue: 2.1e-10, Aligned region: 386..487
Protein Sequence: 582 a.a.     [Download]
>gi|308183678|ref|YP_003927805.1| conjugal transfer protein (traG) [Helicobacter pylori PeCan4]
MIEKFKTLRDKFKDKTSNLFHKLNSIQKDYYTKTLPKACKDVFTLGSSKSYPMTLNFNKGFCVGLYKGLN
SLKPTYYDAPLSTLIIAPPGSGKTAAVAVPNLLSVPSSCVVLDIKGELFDLTAGYRQQVLKNKIFVFDPL
GNDNTLKFNPFDKRTVEKLDFNRKRRLVDEVGNTIFAEDGANKDPHWTQQAKNLFVFYALYDLCVHNTST
FFEIASAPIKNYVPLINPQSRFYTELYECQSSDNGFVKENGRYMAKVENGVKKMKPNVNVELLWYKQVAE
QVYTDPENPKNYDGSVNNLEKDDQGNVIMKEGMLDPVIRNEANKWAKANDKEFASIKSVYSRFMQVFTSY
QVKSATDSMSFEYEDLRVDNISLYIKIAQTDIDTLAPLIRILLESIAKNLLLKESKKFEERVYLFLDEFV
RFGKLPFLLEMPALSRSYGVVLIFITQSNALIEKYYGREDARIVNSTVAYKVIFKMDDLEYAKQVSEEVG
KMTRKTRSHSTEKGQLITGGTSSIGKEAWDLLSAQDIMNIDKDEVIILVSGHKAKPLKLKANYYFKNKEL
LSRINWEVKPNEEVFDESKKDV
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|308182188|ref|NC_014555.1|:1552006-1553754 Helicobacter pylori PeCan4 chromosome, complete genome
ATGATAGAAAAATTCAAAACATTAAGAGATAAATTTAAGGATAAAACCAGCAATTTATTCCATAAGCTTA
ATAGCATTCAAAAAGATTATTACACTAAAACTCTCCCTAAGGCTTGCAAAGATGTCTTTACGCTAGGTTC
TTCTAAGAGTTATCCTATGACCTTAAATTTTAACAAAGGTTTTTGTGTGGGGCTATATAAAGGTTTAAAT
TCACTTAAGCCTACTTATTATGATGCTCCGCTTTCTACTTTAATTATCGCTCCTCCTGGAAGTGGTAAAA
CCGCAGCTGTGGCTGTGCCTAATCTTTTAAGCGTGCCTAGCTCTTGTGTGGTGTTAGATATTAAAGGGGA
GTTGTTTGATTTAACGGCTGGTTACAGACAACAAGTTCTAAAAAATAAAATTTTTGTATTTGATCCCTTA
GGAAATGATAACACGCTTAAATTCAATCCGTTTGATAAACGCACTGTAGAAAAATTAGATTTTAACCGAA
AGCGAAGGCTTGTAGATGAAGTGGGTAATACTATTTTTGCTGAAGATGGGGCAAATAAAGACCCTCATTG
GACACAGCAAGCTAAAAATTTATTTGTCTTTTACGCTCTTTATGATTTGTGTGTGCATAACACTAGCACC
TTTTTTGAAATTGCTAGCGCTCCTATAAAAAATTATGTCCCCTTAATCAATCCACAAAGCCGATTTTATA
CTGAATTATATGAATGTCAAAGTAGTGATAATGGTTTTGTTAAAGAGAATGGGCGTTATATGGCTAAAGT
AGAAAATGGCGTTAAAAAAATGAAACCTAATGTCAATGTGGAATTGCTATGGTATAAACAAGTAGCCGAA
CAAGTCTATACTGACCCAGAAAATCCTAAAAATTATGATGGATCTGTGAATAATTTAGAAAAAGACGATC
AAGGCAATGTTATAATGAAAGAGGGCATGTTAGATCCTGTTATTAGAAACGAAGCGAACAAATGGGCTAA
GGCGAATGATAAAGAGTTTGCGAGCATTAAATCAGTTTATAGCCGTTTTATGCAAGTCTTTACAAGCTAT
CAAGTTAAAAGCGCTACAGATAGCATGAGTTTTGAATACGAGGATTTAAGGGTTGACAATATTTCACTCT
ATATTAAAATCGCTCAAACAGATATTGACACACTCGCACCGCTTATCCGTATCCTTTTGGAAAGTATTGC
TAAAAATCTTTTATTGAAAGAGAGTAAGAAATTTGAAGAAAGGGTTTATCTGTTTTTAGATGAATTTGTG
CGTTTTGGTAAATTGCCTTTTTTATTAGAAATGCCCGCATTAAGTAGGAGCTATGGTGTGGTTTTAATTT
TTATCACGCAATCCAATGCTCTTATTGAAAAATATTATGGTAGAGAAGATGCAAGAATTGTTAATAGCAC
CGTGGCTTACAAAGTAATTTTCAAAATGGATGATTTAGAATATGCTAAACAAGTGAGCGAAGAAGTCGGT
AAGATGACTAGAAAAACACGAAGCCACTCTACAGAAAAAGGACAACTCATTACCGGAGGAACTTCTAGTA
TAGGTAAAGAGGCGTGGGACTTATTGAGCGCGCAAGATATTATGAATATTGATAAAGATGAAGTGATCAT
TTTAGTAAGCGGTCATAAGGCTAAACCCTTAAAATTAAAAGCGAATTATTATTTCAAAAACAAAGAATTA
CTCTCTCGTATTAATTGGGAAGTCAAGCCCAATGAAGAAGTGTTTGATGAATCAAAAAAGGATGTATGA
 Primer design