SecReT4
Protein ID: 308183813
T4SS name [ID]ComB [440]
Gene symbol-
Locus tagHPSJM_00085
StrainHelicobacter pylori SJM180
Repliconchromosome [GenBank: NC_014560] [Browse all T4SS(s) in this replicon]
Location [Strand]13813..14094 [+]
Producthypothetical protein
Component typeComB2
UniProt IDE1Q0V1
KEGG IDhpm:HPSJM_00085
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-09, Aligned region: 6..89
Protein Sequence: 93 a.a.     [Download]
>gi|308183813|ref|YP_003927946.1| hypothetical protein HPSJM_00085 [Helicobacter pylori SJM180]
MSAHFLKIVFLVGMCVSSLFAEGLEGFFNALEAQLKSPIAKGILMVIFIGIAIYVWRNLDRWKEILFTIL
GVVFGIFLFFKAPSLANWFMGIF
 
Nucleotide Sequence: 282 bp     [Download]
>gi|308183796|ref|NC_014560.1|:13813-14094 Helicobacter pylori SJM180 chromosome, complete genome
ATGTCCGCTCATTTTTTAAAAATCGTTTTTTTAGTAGGCATGTGCGTTTCAAGTTTGTTCGCTGAAGGTT
TAGAGGGGTTTTTTAACGCCCTAGAAGCCCAGCTCAAAAGCCCCATCGCTAAGGGGATTTTAATGGTGAT
TTTCATAGGGATCGCCATTTATGTGTGGAGGAATTTGGACCGGTGGAAAGAGATTTTATTCACGATCCTT
GGCGTGGTGTTTGGGATCTTTTTATTCTTTAAAGCCCCGAGTTTGGCGAATTGGTTTATGGGAATTTTTT
AA
 Primer design